Align ATPase (characterized, see rationale)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 149 bits (375), Expect = 1e-40 Identities = 82/224 (36%), Positives = 129/224 (57%), Gaps = 4/224 (1%) Query: 38 LCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHRLSHDRRDIATIR 97 L G+ L + +GE+ ++GPSG GK+T L+ + L+ +G I I G LS + + R Sbjct: 19 LRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRISINGRLLSGPETFVPSER 78 Query: 98 QEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERVRIAEQADKYPGQ 157 +EVGM+FQ + LFPHLTV +N++ V+ A +A ++L V++ +YP + Sbjct: 79 REVGMIFQDYALFPHLTVAENILFG---VKGLDKAARQARLGEMLALVKLEGLGGRYPHE 135 Query: 158 LSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRD-LASEGMTMLVATHE 216 LSGGQQQRV+IARALA +P +LL DEP S +D ++ E++ +R+ L G++ + TH Sbjct: 136 LSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEIREILKQRGVSAVFVTHS 195 Query: 217 VGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQI 260 A AD++ L DG I + + + P +FL Q+ Sbjct: 196 KDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLGQV 239 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 219 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 342 Length adjustment: 27 Effective length of query: 234 Effective length of database: 315 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory