Align TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 5210055 Shew_2502 ABC transporter-related protein (RefSeq)
Query= TCDB::Q9WXN4 (268 letters) >FitnessBrowser__PV4:5210055 Length = 261 Score = 154 bits (388), Expect = 2e-42 Identities = 89/254 (35%), Positives = 148/254 (58%), Gaps = 10/254 (3%) Query: 4 LVVKNLTKIFSLGF--FSKRRIEAVKNVSFEVKEKEIVSLVGESGSGKTTTAKMILRLLP 61 L V L+K F G+ F ++ A++ +SFE+ E +++VGE+GSGK+T A++++ Sbjct: 6 LKVNRLSKTFFAGYKGFKRQYNHALEPISFELNRGETLAIVGETGSGKSTLARILVGAEQ 65 Query: 62 PTSGEIYFEGKDIWKDIKDRESLVEFRRKVHAVFQDPFASYNPFYPVERTLWQAISLLEN 121 T GEI FEG+ + + +L + R + +FQDP S NP V L + + N Sbjct: 66 RTDGEILFEGEAL-----ESRNLKQRCRLIRMIFQDPNTSLNPRLTVGELLDEPLRF--N 118 Query: 122 KPSNKKEALELIKESLFRVGIDPKDVLGKYPHQISGGQKQRIMIARCWILRPLLIVADEP 181 +K+ + ++L +VG+ P+ YPH IS G KQR+ +AR +L P +I+ADE Sbjct: 119 TDLDKQARFAQVVDTLRKVGLLPEHA-DFYPHMISEGMKQRVAVARALMLNPKIIIADEA 177 Query: 182 TSMIDASSRGGIIKLLEELREEQGTSIIFITHDLGLAYYVSDNIFVMKNGEIVERGHPDK 241 + +D S R I+ LL +L++E G S IF++H++ + + SD I V+ G++VE+ +K Sbjct: 178 LTALDLSVRSQILNLLLKLQQEMGLSYIFVSHNMNIIRHFSDKIMVLHQGKMVEKATTEK 237 Query: 242 VVLEPTHEYTKLLV 255 + P HEYT+ L+ Sbjct: 238 LFNAPEHEYTQRLI 251 Lambda K H 0.319 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 261 Length adjustment: 25 Effective length of query: 243 Effective length of database: 236 Effective search space: 57348 Effective search space used: 57348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory