Align TM0028, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)
to candidate 5210054 Shew_2501 oligopeptide/dipeptide ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q9WXN5 (330 letters) >FitnessBrowser__PV4:5210054 Length = 337 Score = 137 bits (344), Expect = 5e-37 Identities = 95/294 (32%), Positives = 161/294 (54%), Gaps = 20/294 (6%) Query: 22 VKAVDGLSFEILEDEVIGVVGESGCGKTTLSNVIFMNMVKPLTLVDGKIFLRVNGEFVEL 81 VKA++ +S + EV G+VGESG G+T L+ I T+ ++ +G+ L Sbjct: 20 VKALERVSLTLNPGEVHGLVGESGSGRTLLAKAILGIPGHNWTIQADRMMW--DGQ--NL 75 Query: 82 SSMTRDEVKRKFWGKEITIIPQAAMNALMPTIRM-EKYVRHLAES-------HGIDEEEL 133 M+ E +R G E+ +I Q +++L P I + + + + E+ G D+ + Sbjct: 76 MDMSPSE-RRVLMGSEMAMIFQDPISSLDPAIAVGTQIIEAMPENKELPWWKRGSDKRK- 133 Query: 134 LDKARRRFEEVGLDPLW--IKRYPFELSGGMRQRAVIAIATILNPSLLIADEPTSALDVV 191 KA++ +VG+ + Y +ELS G Q+ +IAIA P LLIADEPT++++V Sbjct: 134 --KAQQWLHKVGIKETQKIMSSYAWELSDGECQKVMIAIAVANQPRLLIADEPTNSMEVR 191 Query: 192 NQKVLLKVLMQMKRQGIVKSIIFITHDIATVRQIADRMIIMYAGKIVEFAPVESLLEKPL 251 Q + ++L ++ + V SI+ I+H++ T+ Q DR+ +MY+G+++E ++ P Sbjct: 192 TQAQIFRLLSKLNQLQNV-SILLISHELETLSQWCDRLTVMYSGQVMESGVTSDVIANPY 250 Query: 252 HPYTQGLFNSVLT-PEPEVKKRGITTIPGAPPNLINPPSGCRFHPRCPHAMDVC 304 HPYT+ L +++ PE K + T+PG+ P L + P GCR PRCP A +C Sbjct: 251 HPYTKALLDNIPDYSNPEHHKTMMQTLPGSAPALQHLPIGCRLGPRCPQAQKLC 304 Lambda K H 0.321 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 253 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 337 Length adjustment: 28 Effective length of query: 302 Effective length of database: 309 Effective search space: 93318 Effective search space used: 93318 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory