Align CbtD, component of Cellobiose and cellooligosaccharide porter (characterized)
to candidate 5208462 Shew_0974 spermidine/putrescine ABC transporter ATPase subunit (RefSeq)
Query= TCDB::Q97VF5 (362 letters) >FitnessBrowser__PV4:5208462 Length = 378 Score = 126 bits (316), Expect = 1e-33 Identities = 83/264 (31%), Positives = 147/264 (55%), Gaps = 22/264 (8%) Query: 44 MILEVHNLNVIYDEGNSRIIKAVNDVSFGVEKGEILGIIGESGSGKTTLISAILRAIRPP 103 ++L++ ++ ++D+ ++AV+DVS + +GEI ++G SGSGK+TL+ + +P Sbjct: 19 VLLKIERVSKLFDD-----VRAVDDVSLNINRGEIFALLGGSGSGKSTLLRMLAGFEKPT 73 Query: 104 GKIISGKVIFNGMDIFSMTIDEFRKLLWKDISYVPQASQNALNPVLPISEIFYHEAISHG 163 G++ +G DI M E + I+ + Q+ AL P + +++ + Sbjct: 74 ----EGRIYLDGQDITDMPPYE------RPINMMFQSY--ALFPHMTVAQNIAF-GLKQD 120 Query: 164 EADKKRVIERASELLKLVGLDPARVLKMYPFQLSGGMKQRVMIALSLLLNPKLILMDEPT 223 + K + +R E+LKLV ++P K P QLSGG +QRV +A SL PKL+L+DEP Sbjct: 121 KMPKAEIEQRVKEMLKLVHMEP--YAKRKPNQLSGGQRQRVALARSLAKRPKLLLLDEPM 178 Query: 224 SALD-MLNQELLLKLIKNINQEMGVTIVYVTHDILNIAQIANRLLVMYKGYVMEEGKTEE 282 ALD L ++ L+++ +I + +GVT V VTHD +A R+ +M G++ + G + Sbjct: 179 GALDKKLRTQMQLEVV-DILEAVGVTCVMVTHDQEEAMTMAERIAIMNDGWIAQTGSPMD 237 Query: 283 IIKSPLNPYTSLLVSSIPSLKGEV 306 I +SP N + + S+ +G++ Sbjct: 238 IYESPANRMVAEFIGSVNLFEGDI 261 Lambda K H 0.319 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 378 Length adjustment: 30 Effective length of query: 332 Effective length of database: 348 Effective search space: 115536 Effective search space used: 115536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory