Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate 5208201 Shew_0713 transport system permease protein (RefSeq)
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__PV4:5208201 Length = 347 Score = 156 bits (395), Expect = 6e-43 Identities = 98/274 (35%), Positives = 150/274 (54%), Gaps = 7/274 (2%) Query: 59 LRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPT---P 115 LRLPR L+A + G LALAG +LQT+T NP+A P L GI+SGA+L + L Sbjct: 71 LRLPRILLAFIAGFGLALAGAVLQTVTRNPLADPYLFGISSGASLGAVVVITLLGGVGGA 130 Query: 116 IAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLA- 174 +A L A G ++ L+V+ G +T +++L+G+A+S L + L + Sbjct: 131 LASVGLPLGAFIGASLAVLMVLALCGRDLNTQIE-RMLLSGVAISFLFGALASLMLYFSG 189 Query: 175 EDHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVN 234 A + +W G + A WQ +W +V+ A ++LLL Q+ + D TAHTLG+ Sbjct: 190 PQSAASVLFWSLGSFAKASWQMLWLPWLLVLAASAILLLLKRQILAIQAGDETAHTLGIR 249 Query: 235 LTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLM 294 + RLRLV +L L+ V+ G + F+GL+VPH+ R R L ++ L+G M Sbjct: 250 VQRLRLVSLLLCSLITAVLVANCGGIGFVGLMVPHMVRLL--LPGRFALLLTALVGGLFM 307 Query: 295 LLADVLARALAFPGDLPAGAVLALIGSPCFVWLV 328 + DVLAR L +LP G + A+IGS F++++ Sbjct: 308 IWVDVLARCLLSYQELPVGIITAVIGSLFFLFIL 341 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 354 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 347 Length adjustment: 28 Effective length of query: 304 Effective length of database: 319 Effective search space: 96976 Effective search space used: 96976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory