Align Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94) (characterized)
to candidate 5208459 Shew_0971 peptidase C26 (RefSeq)
Query= reanno::SB2B:6938542 (254 letters) >FitnessBrowser__PV4:5208459 Length = 253 Score = 382 bits (982), Expect = e-111 Identities = 182/254 (71%), Positives = 211/254 (83%), Gaps = 1/254 (0%) Query: 1 MSDATIPLIGVSACNTPIGLQTFNTVGEKYLLGVINGTGGWPLIIPSIGDGMPTELLLER 60 MSD + +IGV+ACN IGL FN VGEKYLLG+ + T GWPL+IP++G P E +L R Sbjct: 1 MSDEGLAVIGVTACNQQIGLHPFNIVGEKYLLGIADATQGWPLVIPALGH-CPAETILPR 59 Query: 61 LDGILFTGSPSNVEPHHYSGPASEPGTHHDPRRDATTLPLIKAAIAAGVPVLGICRGFQE 120 LDG+LFTGSPSN+EPHHY G AS+P T HDP+RDAT LPL+KAAI AGVPVL ICRGFQE Sbjct: 60 LDGLLFTGSPSNIEPHHYDGVASDPDTLHDPKRDATNLPLLKAAIDAGVPVLAICRGFQE 119 Query: 121 MNVAFGGSLHQKLHETGVFEEHREDRTAPLEVQYGLAHTVTLEPGGVIFEAWGRSSAEVN 180 MNV +GGSLHQKLHE G + EHRED+TA +EVQYGL+H + +EPGG++ EAWGR+ AEVN Sbjct: 120 MNVVYGGSLHQKLHEVGDYIEHREDKTADVEVQYGLSHPLKIEPGGLLHEAWGRNLAEVN 179 Query: 181 SVHTQGVERLGNGLRPEAYAPDGLIEAFSVTDAKNFALGVQFHPEWKVADNAFYLSIFNA 240 SVHTQGV+RLG GLRPEAYAPDGLIEAFSV DAKNFALGVQFHPEWKV +N FY SIF+A Sbjct: 180 SVHTQGVDRLGVGLRPEAYAPDGLIEAFSVKDAKNFALGVQFHPEWKVLENPFYRSIFSA 239 Query: 241 FGDACRRRAQERAR 254 F AC+ RA +R R Sbjct: 240 FSQACQARAAQRKR 253 Lambda K H 0.319 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 322 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 253 Length adjustment: 24 Effective length of query: 230 Effective length of database: 229 Effective search space: 52670 Effective search space used: 52670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory