GapMind for catabolism of small carbon sources

 

Aligments for a candidate for adh in Shewanella loihica PV-4

Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate 5208068 Shew_0580 succinylglutamic semialdehyde dehydrogenase (RefSeq)

Query= BRENDA::P76217
         (492 letters)



>lcl|FitnessBrowser__PV4:5208068 Shew_0580 succinylglutamic
           semialdehyde dehydrogenase (RefSeq)
          Length = 487

 Score =  581 bits (1497), Expect = e-170
 Identities = 279/484 (57%), Positives = 368/484 (76%)

Query: 1   MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSFAE 60
           M+ +ING W+ G G   V +NP + EV+W+   A   QV  A  AARAA   W  L F  
Sbjct: 2   MSQFINGQWVAGLGHDVVSKNPANQEVIWESKTATPEQVNAAVEAARAAQFDWFMLGFDA 61

Query: 61  RHAVVERFAALLESNKAELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQR 120
           R A+VE +   LE++K ++  +IA+ETGKP+WE ATE  AMI KI +S+ AYH RTG   
Sbjct: 62  RLAIVEAYRDQLEAHKGDIAEVIAQETGKPQWETATEAGAMIGKIGLSVAAYHKRTGTSE 121

Query: 121 SEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAV 180
           ++ P G A LRH+PHGV+AVFGPYNFPGHLPNGHIVPALLAGNT++FKPSELTP + E +
Sbjct: 122 NDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTVVFKPSELTPKTAELM 181

Query: 181 MRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKIL 240
           ++LW++AGLP GV+NLVQG  ETG+AL++   +DGL FTGS+ TG+ LH+Q +G P KIL
Sbjct: 182 LKLWEKAGLPAGVINLVQGEVETGKALASHPQIDGLFFTGSSRTGHILHQQYAGHPGKIL 241

Query: 241 ALEMGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVA 300
           ALEMGGNNPLII  V D  AAVH  IQSA++++GQRCTCARRL ++ GA+GDA LA+L  
Sbjct: 242 ALEMGGNNPLIIKGVKDTLAAVHDIIQSAYISSGQRCTCARRLYVEKGAEGDALLAKLAE 301

Query: 301 VSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRPLLAPRLLQAGTSLLTP 360
             +++  G W+ +PQPF+G +ISE AA+ +V A + L  +GG PL+  + L+AGT L++P
Sbjct: 302 AVKQIKVGPWNAQPQPFMGSMISEAAAKGMVEAQRNLINLGGTPLVELKHLEAGTGLVSP 361

Query: 361 GIIEMTGVAGVPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGLSCGLVSPEREKFDQLLL 420
           G+I++T V  +PDEE FGPLL+V RY  FDEAI++AN+TR+GLS G+++  RE +D  L 
Sbjct: 362 GLIDVTQVIELPDEEYFGPLLQVVRYTDFDEAIKLANDTRYGLSAGILADSREDYDYFLA 421

Query: 421 EARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLESDSLTLPATL 480
             RAGIVNWNK +TGA+ +APFGG+GASGNHR SA+YAADYCA+P+AS+E+D+L +PA+L
Sbjct: 422 RIRAGIVNWNKQITGASGSAPFGGVGASGNHRASAFYAADYCAYPVASVEADALAMPASL 481

Query: 481 NPGL 484
           +PGL
Sbjct: 482 SPGL 485


Lambda     K      H
   0.318    0.134    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 781
Number of extensions: 30
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 492
Length of database: 487
Length adjustment: 34
Effective length of query: 458
Effective length of database: 453
Effective search space:   207474
Effective search space used:   207474
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory