Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate 5210989 Shew_3415 short chain dehydrogenase (RefSeq)
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__PV4:5210989 Length = 268 Score = 80.5 bits (197), Expect = 3e-20 Identities = 64/201 (31%), Positives = 97/201 (48%), Gaps = 9/201 (4%) Query: 15 VLISGAAAGIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGV------ADVSD 68 V+I+GA+ GIG A+A+A +G + + + + + A V ADV+D Sbjct: 9 VIITGASEGIGRALAKAMAPLGCRLVLTARSQGRLHSLQQELSSI-ASVPPLVIPADVTD 67 Query: 69 CAQVDRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKA 128 A +ID + LD+L+NNAG+ + E D + ER + N + A Sbjct: 68 AAACQGLIDACVAHFDRLDILVNNAGMTMWSRFDELEDLSILERVMQVNYLAPAMLTHFA 127 Query: 129 VPLLKETSANPGIIAMASVAGRLGYAFRTPYAASKWAIVGMVKSLAIELGPNNVRVNAIL 188 +P LK + I+ +ASVAG G R+ Y+ASK A++G SL IEL ++V V I Sbjct: 128 LPHLKASRGQ--IVVVASVAGLTGVPTRSGYSASKHAVMGFFDSLRIELVEHDVAVTHIC 185 Query: 189 PGVVEGERMDRVISARAESLG 209 P V E R + + LG Sbjct: 186 PDFVVSEIHKRALDGQGNPLG 206 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 268 Length adjustment: 25 Effective length of query: 238 Effective length of database: 243 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory