Align glycerate 2-kinase (EC 2.7.1.165) (characterized)
to candidate 5210090 Shew_2534 glycerate kinase (RefSeq)
Query= BRENDA::P23524 (381 letters) >FitnessBrowser__PV4:5210090 Length = 381 Score = 400 bits (1029), Expect = e-116 Identities = 212/380 (55%), Positives = 263/380 (69%), Gaps = 4/380 (1%) Query: 1 MKIVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAE 60 MKIVIAPDSYKESLSA EVA I +GF E+ PDA+Y+ +PVADGGEGTV++M+ AT G Sbjct: 1 MKIVIAPDSYKESLSAMEVATEIARGFCEVLPDAEYIKLPVADGGEGTVQSMVDATGGKL 60 Query: 61 RHAWVTGPLGEKVNASWGISGDG----KTAFIEMAAASGLELVPAEKRDPLVTTSRGTGE 116 VTGPLG +V+A +G+ G +TA IEMA+ASGL VP RDPLVTTS GTGE Sbjct: 61 VELKVTGPLGSQVDAHYGLLGQEAPGQRTAVIEMASASGLHHVPTLLRDPLVTTSYGTGE 120 Query: 117 LILQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDI 176 LI AL SG T++I+G+GGSATNDGGAGM+QALGA L D G + GG +L L +DI Sbjct: 121 LICHALNSGVTHLILGLGGSATNDGGAGMLQALGAHLLDNEGKPLRPGGAALEHLASVDI 180 Query: 177 SGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKA 236 L PRL I VACDV NPL GD GAS IFGPQKGA E M+ LDN LSH+A++ Sbjct: 181 GELHPRLAQVEIEVACDVDNPLCGDKGASAIFGPQKGADEIMVARLDNALSHFADITSSV 240 Query: 237 LHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRID 296 + +++PGAGAAGGMG A++A+LGA+L+ GI+IV + L EH+ LVITGEGR+D Sbjct: 241 GLKECRNMPGAGAAGGMGFAMLAYLGAKLRPGIDIVMETVRLSEHLKGADLVITGEGRLD 300 Query: 297 SQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFR 356 SQ++HGK P+GV A K PVI IAG +++D V+ HGIDA+FSV L+E Sbjct: 301 SQTLHGKTPMGVTREANKQGIPVIAIAGCVSEDANVLLDHGIDALFSVTPRALPLEEVLA 360 Query: 357 GAYDNICRASRNIAATLAIG 376 GA N+ + NIA +G Sbjct: 361 GARHNLYSCAVNIARLYRLG 380 Lambda K H 0.315 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 381 Length adjustment: 30 Effective length of query: 351 Effective length of database: 351 Effective search space: 123201 Effective search space used: 123201 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory