Align MFS transporter, FHS family, L-fucose permease (characterized, see rationale)
to candidate 5209419 Shew_1890 glucose/galactose transporter (RefSeq)
Query= uniprot:A0A1I2JXG1 (442 letters) >FitnessBrowser__PV4:5209419 Length = 421 Score = 435 bits (1118), Expect = e-126 Identities = 225/412 (54%), Positives = 296/412 (71%), Gaps = 12/412 (2%) Query: 24 DYPMAMGVLTSIFFMWGFLTCLNDILIPHLKAVFKLNYAEAMLVQFTFFGAYFLMSLPAG 83 +Y A+ LTS+FFMWGF+TCLNDILIPHLKA F LNYAEAML+QF FFGAYFL+S+PAG Sbjct: 19 NYRFALVSLTSLFFMWGFITCLNDILIPHLKAAFSLNYAEAMLIQFCFFGAYFLVSMPAG 78 Query: 84 LLVARLGYKKGIVAGLAVAGVGAAGFWPAAAMHFYPAFLGALFVLATGITVLQVAANAYV 143 LV LGY+KGIV GL +A +G A F+PAAA+ Y FLGALFVLA+GIT+LQVAAN YV Sbjct: 79 KLVKALGYQKGIVTGLLIAALGCALFYPAAALATYGLFLGALFVLASGITILQVAANPYV 138 Query: 144 ALLGPEKSASSRLTLAQALNSLGTFLAPKFGGLLILSAAVLSAEQIAKLSPAEQVAYRVQ 203 LG ++ASSRL L QA N+LGT +AP FG +LILS AV ++E + + Sbjct: 139 NALGSVETASSRLNLTQAFNALGTTVAPYFGAVLILSVAVEASETLTQAQ---------A 189 Query: 204 EAQTVQGPYLGLAIVLFLLAVFVYLFRLPALTE---KTEQASVKQHSLVSPLRHPHVLFG 260 EA+ V+ PYL LA L +LA+ LP + E EQ V + S L+ H++ G Sbjct: 190 EAEVVKLPYLILATALGVLALVFAKLDLPQIKEHCQSGEQGEVVHNGKTSALQSLHLVLG 249 Query: 261 VLAIFFYVGGEVAIGSFLVNYLSMPDIGNMSEQAAANWVAYYWLGAMIGRFIGSALLAKL 320 + IF YVG EV+IGSFLVN+L+ DI +SE +AA+++ YYW GAM+GRFIGSA++ K+ Sbjct: 250 AVGIFVYVGAEVSIGSFLVNFLAQDDIAGLSEASAASYITYYWGGAMVGRFIGSAVMQKV 309 Query: 321 SPRKLLAIFAAINMALVLTTMMTKGTVAMYSVVSIGLFNSIMFPTIFSLGIERMGPMTGE 380 +L A + LV M + GTVAM++++++GLFNSIMFPTIFSL + +GP T + Sbjct: 310 PAGTVLGFNALMAALLVALAMTSTGTVAMWAILAVGLFNSIMFPTIFSLALRDLGPHTSQ 369 Query: 381 ASSLLIMAIVGGAIVPFVQGLFADHIGVQHAFFLPLLCYAYIVFYGLYGSRI 432 S +L +AIVGGAI+P +QG+ AD+IG+QHAFFLP++CY +I+FYG+ GS++ Sbjct: 370 GSGVLCLAIVGGAILPLLQGVLADNIGIQHAFFLPIICYLFIMFYGVKGSKL 421 Lambda K H 0.327 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 560 Number of extensions: 27 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 442 Length of database: 421 Length adjustment: 32 Effective length of query: 410 Effective length of database: 389 Effective search space: 159490 Effective search space used: 159490 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory