Align Lactaldehyde reductase (characterized, see rationale)
to candidate 5209439 Shew_1910 bifunctional acetaldehyde-CoA/alcohol dehydrogenase (RefSeq)
Query= uniprot:Q8A199 (384 letters) >FitnessBrowser__PV4:5209439 Length = 872 Score = 223 bits (567), Expect = 2e-62 Identities = 151/411 (36%), Positives = 218/411 (53%), Gaps = 35/411 (8%) Query: 6 LNETSYFGAGCRSVIAVEAARRGFKKAFFVTDKDLIKFGVAAEIIKVFDDNHIPYELYSD 65 L + YF G + E + + K+A VTDK L G E IK+ + E++ + Sbjct: 456 LPSSIYFRRGSLPIALEELSDK--KRALIVTDKYLFNNGYCDETIKILKSQGLETEVFYE 513 Query: 66 VKANPTIANVQNGVAAYKASGADFIVALGGGSSIDTAKGIGIVVNNP--DFADVKSLEGV 123 V+A+PT+A V G + K+ D I+ALGGGS +D AK I ++ +P DFAD+ +L + Sbjct: 514 VEADPTLAIVNQGASVAKSFQPDVIIALGGGSPMDAAKIIWVMYEHPEVDFADL-ALRFM 572 Query: 124 ADTKH--------KAVPTFALPTTAGTAAEVTINYVIIDEDARKKMVCVDPNDIPAVAIV 175 K K A+PTT+GT +EVT V+ DE K D P +AIV Sbjct: 573 DIRKRIYKFPKLGKKAKMVAIPTTSGTGSEVTPFAVVTDEQTGMKYPIADYELTPNMAIV 632 Query: 176 DPELMYSMPKGLTAATGMDALTHAIESYITPGAWAMSDMFELKAIEMIAQNLKAAVDNGK 235 DP L+ MPK LTA G+DA+THA+E+Y++ A SD L+A++++ + L + G Sbjct: 633 DPNLVMDMPKSLTAFGGIDAITHALEAYVSVMANEYSDGQALQALDLLVKYLPDSYALGA 692 Query: 236 DT-VAREAMSQAQYIAGMGFSNVGLGIVHSMAHPLGAFYDTPHGVANALLLPYVMEYNA- 293 VARE + IAG+ F+N LGI HSMAH LGA + HG+ANALL+ V+ +NA Sbjct: 693 QAPVAREKVHNGATIAGIAFANAFLGICHSMAHKLGAEFHLAHGLANALLISNVIRFNAT 752 Query: 294 -------------ESPAAPKYIHIA---KAMGVNTDGMTETEGVKAAIEAVKALSLSIGI 337 A +Y IA K G +G+++ E V+A +E + L +IGI Sbjct: 753 DLPTKQAAFSQYDRPKALCRYAKIAEHLKLKGATGEGISDEEKVEALLEKIDELKKTIGI 812 Query: 338 PQKLHEINVKEED----IPALAVAAFNDVCTGGNPRPTSVAEIEVLYRKAF 384 P + E V E D + LA AF+D CTG NPR +AE++ + +F Sbjct: 813 PASIQEAGVNEADFFAKLDELAEDAFDDQCTGANPRYPLIAELKAILTASF 863 Lambda K H 0.317 0.133 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 770 Number of extensions: 44 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 872 Length adjustment: 36 Effective length of query: 348 Effective length of database: 836 Effective search space: 290928 Effective search space used: 290928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory