Align galactose kinase (characterized)
to candidate 5209834 Shew_2287 galactokinase (RefSeq)
Query= CharProtDB::CH_024146 (382 letters) >FitnessBrowser__PV4:5209834 Length = 393 Score = 371 bits (952), Expect = e-107 Identities = 193/387 (49%), Positives = 259/387 (66%), Gaps = 12/387 (3%) Query: 5 EKTQSL---FANAFGYPATHTIQAPGRVNLIGEHTDYNDGFVLPCAIDYQTVISCAPRDD 61 E TQ+L F AFG A APGRVNLIG+HTDYN G+VLP A+D T ++ + RDD Sbjct: 5 ELTQALPYAFNQAFGQEAALVAYAPGRVNLIGDHTDYNLGWVLPVALDRGTSVAASQRDD 64 Query: 62 RKVRVMAADYENQLDEFSLDAPIVAHENYQ----WANYVRGVVKHLQLRNNSFG-----G 112 +++V+A D +N+ FSLD +A W+NYVRG VK L G G Sbjct: 65 SQIQVVARDMDNEKVSFSLDDQAMAQMPLDSVSPWSNYVRGTVKMLSAYLAETGQPPLRG 124 Query: 113 VDMVISGNVPQGAGLSSSASLEVAVGTVLQQLYHLPLDGAQIALNGQEAENQFVGCNCGI 172 ++ISGN+P+GAGLSSSASLE+A+ L+ L +DG + A GQ+AEN+FVGCNCGI Sbjct: 125 ASLMISGNLPKGAGLSSSASLEMALIKAFAGLFDLKVDGIKAAQLGQQAENEFVGCNCGI 184 Query: 173 MDQLISALGKKDHALLIDCRSLGTKAVSMPKGVAVVIINSNFKRTLVGSEYNTRREQCET 232 MDQLISA+G+ + A+LIDC L K V +P G+ ++IINSN KRTLVGSEYN RREQC+ Sbjct: 185 MDQLISAMGEAERAMLIDCSDLAIKQVPLPAGLRLMIINSNVKRTLVGSEYNLRREQCQQ 244 Query: 233 GARFFQQPALRDVTIEEFNAVAHELDPIVAKRVRHILTENARTVEAASALEQGDLKRMGE 292 A+ F +LR V+ E+ L+P + +R RH+++ENAR +E A AL GD +G Sbjct: 245 VAQHFGVSSLRQVSYEQLCRAEASLEPTLFRRARHVVSENARVLEMAEALSAGDNAYIGR 304 Query: 293 LMAESHASMRDDFEITVPQIDTLVEIVKAVIGDKGGVRMTGGGFGGCIVALIPEELVPAV 352 LMA SH S+RDDF ++ P++D LVE+V V+G GG RMTGGGFGGC+VAL+PE + V Sbjct: 305 LMAASHRSLRDDFAVSTPEVDCLVELVSEVLGMDGGARMTGGGFGGCVVALLPEHKIAEV 364 Query: 353 QQAVAEQYEAKTGIKETFYVCKPSQGA 379 ++ +A +Y+A+TG+ Y+C+ GA Sbjct: 365 RETIAVEYQARTGLTADIYLCQSGAGA 391 Lambda K H 0.318 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 393 Length adjustment: 30 Effective length of query: 352 Effective length of database: 363 Effective search space: 127776 Effective search space used: 127776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 5209834 Shew_2287 (galactokinase (RefSeq))
to HMM TIGR00131 (galK: galactokinase (EC 2.7.1.6))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00131.hmm # target sequence database: /tmp/gapView.8002.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00131 [M=388] Accession: TIGR00131 Description: gal_kin: galactokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-122 392.7 0.0 9.7e-122 392.5 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209834 Shew_2287 galactokinase (RefSeq) Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209834 Shew_2287 galactokinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 392.5 0.0 9.7e-122 9.7e-122 5 385 .. 11 391 .. 7 393 .] 0.94 Alignments for each domain: == domain 1 score: 392.5 bits; conditional E-value: 9.7e-122 TIGR00131 5 kkiFasaykekpdlvvraPGRvnliGehiDYndgsvlPlaidvdtlvavkerddknvsitlanadnklaerkldlpld 82 +F++a+++++ lv++aPGRvnliG+h+DYn g vlP+a+d +t va+ +rdd ++++++ ++dn+ ++ld++ lcl|FitnessBrowser__PV4:5209834 11 PYAFNQAFGQEAALVAYAPGRVNLIGDHTDYNLGWVLPVALDRGTSVAASQRDDSQIQVVARDMDNEKVSFSLDDQAM 88 568***********************************************************************9988 PP TIGR00131 83 ksev....sdWanYvkgvlkvlq...eRfnsvpl.GldivisgdvPtgaGLsssaalevavaavlknlgkleldskei 152 ++ s W+nYv+g++k+l + pl G+ ++isg++P+gaGLsssa+le+a+ + l++l++d+ + lcl|FitnessBrowser__PV4:5209834 89 AQMPldsvSPWSNYVRGTVKMLSaylAETGQPPLrGASLMISGNLPKGAGLSSSASLEMALIKAFAGLFDLKVDGIKA 166 766566669*************9554233334557******************************************* PP TIGR00131 153 llriqkveehfvGvncGgmDqlasvlGeedhallvefrkLkatpvklpqleialviantnvksnlapseYnlRrqeve 230 ++ +q++e++fvG+ncG+mDql+s++Ge + a+l+++ L ++v+lp ++ l+i+n+nvk++l++seYnlRr++++ lcl|FitnessBrowser__PV4:5209834 167 AQLGQQAENEFVGCNCGIMDQLISAMGEAERAMLIDCSDLAIKQVPLPA-GLRLMIINSNVKRTLVGSEYNLRREQCQ 243 *************************************************.**************************** PP TIGR00131 231 eaakvlakksekgaLrDvkeeefaryearltkllqlvekqRakhvvsenlRvlkavkllkdedlkelGkLmnesqasl 308 + a+ + ++ +Lr v+ e+ r ea l++ + Ra+hvvsen+Rvl+ +++l +d +G+Lm++s+ sl lcl|FitnessBrowser__PV4:5209834 244 QVAQHFGVS----SLRQVSYEQLCRAEAS---LEPTLFR-RARHVVSENARVLEMAEALSAGDNAYIGRLMAASHRSL 313 *******99....9*****9999976654...5666666.************************************** PP TIGR00131 309 dddyeitvpeidelvesialvnG.siGsRltGaGfGGCtvalvpnenvekvrkalaekYekktdlklefavivskeal 385 +dd+ ++ pe+d lve++ v G +G+R+tG+GfGGC+val+p+ ++ +vr+++a +Y++ t+l ++ ++++s+ ++ lcl|FitnessBrowser__PV4:5209834 314 RDDFAVSTPEVDCLVELVSEVLGmDGGARMTGGGFGGCVVALLPEHKIAEVRETIAVEYQARTGLTADIYLCQSGAGA 391 ***********************99************************************************98875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (388 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory