Align 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 (characterized)
to candidate 5210117 Shew_2561 6-phosphogluconate dehydrogenase (RefSeq)
Query= CharProtDB::CH_122771 (517 letters) >FitnessBrowser__PV4:5210117 Length = 513 Score = 437 bits (1124), Expect = e-127 Identities = 241/504 (47%), Positives = 314/504 (62%), Gaps = 37/504 (7%) Query: 30 DIGLIGLAVMGQNLILNMADHGYTVVAYNRTTAKVDRFLENEAK------GKSILGAHSI 83 DIG+IGL VMG+NL LN+AD+ Y V A++ + K D LE E K + ILG ++ Sbjct: 9 DIGVIGLGVMGKNLALNIADNRYRVAAFDLDSTKRDALLEQEQKERPALQAQRILGCSNL 68 Query: 84 KELVDQLKRPRRIMLLVKAGAPVDEFINQLLPY-LEEGDIIIDGGNSHFPDSNRRYEELA 142 E++ L +PR ++L V AGAPVD N LL +E+ DI++D GNS + D+ R + Sbjct: 69 SEMLSSLAKPRVLVLSVPAGAPVDGVCNALLEAGIEQDDIVVDTGNSLWTDTVAREAQYQ 128 Query: 143 KKGILFVGSGVSGGEEGARTGPSLMPGGNEKAWPHIKDIFQDVAAKSD------------ 190 K I F +SGGE GAR GPSLMP G+ KAW IK I++ +AAK D Sbjct: 129 DKFIFF-SCAISGGEMGARFGPSLMPSGDIKAWDRIKPIWEAIAAKVDPKTGLPIERQEP 187 Query: 191 ------GEPCCDWVGDAGAGHYVKMVHNGIEYGDMQLICEAYDLMKRVGKFEDKEIGDVF 244 GEPC ++G AGAGHYVKMVHNGIEY DMQLICEAY L+ E+G +F Sbjct: 188 GNPVTEGEPCTTYIGPAGAGHYVKMVHNGIEYADMQLICEAYQLLSDGLGLSAAEVGKIF 247 Query: 245 ATWNKGVLDSFLIEITRDILYYNDPTDGKPLVEKILDTAGQKGTGKWTAVNALDLGIPVT 304 A WN+G L+S+L+EI+ D+L DP GKPLVE ILD AGQKGTG WTAV++L +G P Sbjct: 248 ARWNQGSLNSYLMEISADVLSQADPLTGKPLVEMILDKAGQKGTGLWTAVSSLQIGCPAP 307 Query: 305 LIGEAVFSRCLSAMKAERVEASKALKGPQVTGESPITDKKQFIDDLEQALYASKIISYTQ 364 I EAV++R +S K +R + S L GP+ S ++ FID+LE ALY +KI Y Q Sbjct: 308 TIAEAVYARAVSTQKHQRQQLSLLLAGPEALTLSD-DERAAFIDELENALYCAKIACYAQ 366 Query: 365 GFMLMNQAAKDYGWKLNNAGIALMWRGGCIIRSVFLAEITAAY----RKKPDLENLLLYP 420 GF LM A++ GW+L+ A IA +WR GCIIR+ FL IT AY R L+NLL+ Sbjct: 367 GFQLMAMNAQERGWRLDFAEIAKIWRAGCIIRATFLQSITQAYQQAQRAGESLDNLLMAE 426 Query: 421 FFNDAITKAQSGWRASVGKAIQYGIPTPAFSTALAFYDGLRSERLPANLLQAQRDYFGAH 480 F+ A++ Q WR +V +AI G+P P +ALA+YD RSE LPANLLQ QRD+FGAH Sbjct: 427 TFSLALSAKQQDWRRAVARAIMSGVPVPCIGSALAYYDSYRSETLPANLLQGQRDFFGAH 486 Query: 481 TFKVLPGQENELLKKDEWIHINWT 504 TF+ + + E H+NW+ Sbjct: 487 TFERID------MPAGEKYHLNWS 504 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 611 Number of extensions: 24 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 513 Length adjustment: 35 Effective length of query: 482 Effective length of database: 478 Effective search space: 230396 Effective search space used: 230396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
Align candidate 5210117 Shew_2561 (6-phosphogluconate dehydrogenase (RefSeq))
to HMM TIGR00873 (gnd: 6-phosphogluconate dehydrogenase (decarboxylating) (EC 1.1.1.44))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00873.hmm # target sequence database: /tmp/gapView.444.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00873 [M=467] Accession: TIGR00873 Description: gnd: 6-phosphogluconate dehydrogenase (decarboxylating) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-179 583.8 0.0 1.3e-133 432.2 0.0 2.0 2 lcl|FitnessBrowser__PV4:5210117 Shew_2561 6-phosphogluconate deh Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210117 Shew_2561 6-phosphogluconate dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.9 0.0 5.4e-48 5.4e-48 1 162 [. 9 176 .. 9 183 .. 0.92 2 ! 432.2 0.0 1.3e-133 1.3e-133 160 466 .. 192 504 .. 185 505 .. 0.96 Alignments for each domain: == domain 1 score: 149.9 bits; conditional E-value: 5.4e-48 TIGR00873 1 diGliGlavmGknlvlniadkGfsvavynrtkektdellkeeakg......kklvgaesieefvkslekPrkilllvk 72 diG+iGl+vmGknl+lniad+ + va+++ +++k d+ll++e+k+ +++ g +++ e+++sl kPr ++l v lcl|FitnessBrowser__PV4:5210117 9 DIGVIGLGVMGKNLALNIADNRYRVAAFDLDSTKRDALLEQEQKErpalqaQRILGCSNLSEMLSSLAKPRVLVLSVP 86 79*************************************9987652222226899999******************** PP TIGR00873 73 aGaavdavieellpl.lekgdiiidGGnslykdterrekelkekgilfvGvGvsGGeeGarkGPslmpGGskeayelv 149 aGa+vd v ++ll++ +e+ di++d Gnsl++dt re + ++k i f +sGGe Gar+GPslmp G+ +a++ + lcl|FitnessBrowser__PV4:5210117 87 AGAPVDGVCNALLEAgIEQDDIVVDTGNSLWTDTVAREAQYQDKFI-FFSCAISGGEMGARFGPSLMPSGDIKAWDRI 163 ***********987559**********************9998866.66899************************** PP TIGR00873 150 epilqkiaakveg 162 +pi ++iaakv+ lcl|FitnessBrowser__PV4:5210117 164 KPIWEAIAAKVDP 176 ***********95 PP == domain 2 score: 432.2 bits; conditional E-value: 1.3e-133 TIGR00873 160 vegepcceyiGedGaGhyvkmvhnGieygdmqliaeayellkealklsaeeiaevfeeWnegeldsylieitadilkk 237 +egepc++yiG++GaGhyvkmvhnGiey+dmqli+eay+ll ++l+lsa e+ ++f++Wn+g+l+syl+ei+ad+l++ lcl|FitnessBrowser__PV4:5210117 192 TEGEPCTTYIGPAGAGHYVKMVHNGIEYADMQLICEAYQLLSDGLGLSAAEVGKIFARWNQGSLNSYLMEISADVLSQ 269 689*************************************************************************** PP TIGR00873 238 kded.GkplvdkildaagqkGtGkWtaidaldlGvPvtlitesvfarvlsslkeervaaskllsgplaeekae.dkee 313 d Gkplv++ild+agqkGtG Wta+++l+ G P +i+e+v+ar++s++k++r + s ll+gp+a + + ++++ lcl|FitnessBrowser__PV4:5210117 270 ADPLtGKPLVEMILDKAGQKGTGLWTAVSSLQIGCPAPTIAEAVYARAVSTQKHQRQQLSLLLAGPEALTLSDdERAA 347 **977************************************************************988776553899* PP TIGR00873 314 fiedvrealyaskivsyaqGfallkeaskeygwdlnlgeialiwrgGciirskfldkikkafeenp....elenllla 387 fi+++++aly++ki +yaqGf+l+++ ++e+gw l+++eia+iwr+Gciir++fl++i++a+++ + +l nll+a lcl|FitnessBrowser__PV4:5210117 348 FIDELENALYCAKIACYAQGFQLMAMNAQERGWRLDFAEIAKIWRAGCIIRATFLQSITQAYQQAQrageSLDNLLMA 425 **************************************************************98652222689***** PP TIGR00873 388 eyfkdalkkaqkglrkvvakaielgipvPalsaalsfydgyrtarlpanllqaqrdyfGahtyertdkprgeffhteW 465 e f al+++q+++r++va+ai +g+pvP++ +al++yd+yr+++lpanllq+qrd+fGaht+er+d+p ge++h +W lcl|FitnessBrowser__PV4:5210117 426 ETFSLALSAKQQDWRRAVARAIMSGVPVPCIGSALAYYDSYRSETLPANLLQGQRDFFGAHTFERIDMPAGEKYHLNW 503 ****************************************************************************** PP TIGR00873 466 l 466 + lcl|FitnessBrowser__PV4:5210117 504 S 504 8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (467 nodes) Target sequences: 1 (513 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.14 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory