Align ABC transporter for D-Glucosamine Hydrochloride, permease component 2 (characterized)
to candidate 5210737 Shew_3165 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= reanno::pseudo6_N2E2:Pf6N2E2_2052 (220 letters) >FitnessBrowser__PV4:5210737 Length = 226 Score = 113 bits (282), Expect = 3e-30 Identities = 63/200 (31%), Positives = 111/200 (55%), Gaps = 1/200 (0%) Query: 17 LLAGLGLGLSLALVSIAIGCVIGLAMAFALLSKHRVLRVLASVYVTVIRNTPILVLILLI 76 +L GL + L + L ++ +G ++G+A +S LR A++YV VIR TP++V ++++ Sbjct: 24 ILNGLKVTLIVTLFAMILGAILGVATTLMKMSSRWYLRWPANLYVGVIRGTPVVVQLVIL 83 Query: 77 YFALPSLGIRLDKLPSFVITLSLYAGAYLTEVFRGGLLSIHKGQREAGLAIGLGEWQVKA 136 YF + + +DK+ + +I L +GAY++E+ R G+ ++ KGQ EA ++GL + Sbjct: 84 YFIVLATW-DVDKVSAAIIAFGLNSGAYISEIIRAGIQAVDKGQTEAARSLGLSQAVTMK 142 Query: 137 YVTVPVMLRNVLPALSNNFISLFKDTSLAAAIAVPELTYYARKINVESYRVIETWLVTTA 196 V +P ++N+LPAL N FI L K+T++ I +L I ++ Sbjct: 143 EVILPQAIKNILPALGNEFIVLLKETAVIGFIGGVDLMRSGEIIRSRTFEDSVPLFTCAL 202 Query: 197 LYVAACYLIAMLLRYFEQRL 216 +Y+A Y +L FE+RL Sbjct: 203 IYLALTYSFTFMLSKFEKRL 222 Lambda K H 0.330 0.142 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 129 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 220 Length of database: 226 Length adjustment: 22 Effective length of query: 198 Effective length of database: 204 Effective search space: 40392 Effective search space used: 40392 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory