Align Glucosamine kinase GspK; GlcN kinase; EC 2.7.1.8 (characterized)
to candidate 5208605 Shew_1116 ATPase, BadF/BadG/BcrA/BcrD type (RefSeq)
Query= SwissProt::Q9KUA9 (294 letters) >FitnessBrowser__PV4:5208605 Length = 299 Score = 147 bits (370), Expect = 4e-40 Identities = 94/279 (33%), Positives = 133/279 (47%), Gaps = 1/279 (0%) Query: 5 VGIDGGGTSCRARIRNQQGEWVGEAKSGSANIMLGVEVALRSVVDAITQAAEQGGLSPDD 64 +GIDGGG+ CRA I +G +G AN + G+ S+ A A + GL D Sbjct: 13 IGIDGGGSKCRATIYAADDSVLGTGVAGRANPLYGLTHTFDSISRATELALQDAGLKAGD 72 Query: 65 FPSMHVGLALAGAEQKEAWHAFMQQAHPFASITLNTDAYGACLGAHLGEEGAIMIAGTGS 124 +M G+ LAG + A HPFA + + TD + AC+GAH G +GA++I GTGS Sbjct: 73 GKTMVAGVGLAGVNVAHLYQAIKAWQHPFAEMYVTTDLHTACIGAHKGGDGAVIITGTGS 132 Query: 125 CGILLKGGKQYVVGGREFPISDQGSGAVMGLRLIQQVLLAQDGIRPHTPLCDVVMNHFN- 183 CG G + +GG F + D+GSGA +GL+ QQVLL DG P T L + ++ HF Sbjct: 133 CGYAHVGEQSLSLGGHGFALGDKGSGAWLGLQAAQQVLLDLDGFGPATQLTERLLEHFKV 192 Query: 184 HDIDSIVAWSKTALPRDYGQFSPQIFSHAYCGDPLAIELLKQTAADIEMFLIALHHKGAE 243 +D IV Y + + S A D +A ++ + A I L Sbjct: 193 NDAMGIVEHLAGKSSGCYATLARTVLSCAQAQDEVAKAIVVEGAEYISALAHKLFEIHPP 252 Query: 244 RICLMGSIAERIQDWLSPPVQQWIVKPQSDAIEGALMFA 282 R ++G +AE + WL V I + GA FA Sbjct: 253 RFSMIGGLAEPLAPWLDKRVVDKISPILAPPELGAAYFA 291 Lambda K H 0.320 0.137 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 285 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 299 Length adjustment: 26 Effective length of query: 268 Effective length of database: 273 Effective search space: 73164 Effective search space used: 73164 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory