GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Shewanella loihica PV-4

Align N-acetylglucosamine-specific PTS system, I, HPr, and IIA components (nagF) (characterized)
to candidate 5208528 Shew_1039 phosphoenolpyruvate-protein phosphotransferase PtsP (RefSeq)

Query= reanno::pseudo5_N2C3_1:AO356_17540
         (837 letters)



>lcl|FitnessBrowser__PV4:5208528 Shew_1039
           phosphoenolpyruvate-protein phosphotransferase PtsP
           (RefSeq)
          Length = 743

 Score =  286 bits (732), Expect = 3e-81
 Identities = 197/618 (31%), Positives = 315/618 (50%), Gaps = 19/618 (3%)

Query: 220 MMGLAITEQAQVHVSCRGSDAEAALQALLTTLSTALVEEAHASAPPPEPPRANAEEGVLH 279
           ++G+ + +QA      + S+AE A    L       V E    A     P    ++ V  
Sbjct: 119 ILGVLVVQQADAR---QFSEAEEAFLMTLAAQLAVAVREQRKKAEVKSAP----DKCVYT 171

Query: 280 GVCAAPGLVTGPLVRLSGIQLPEDIGGHA---IEEQRQRLSDALAQVRGEIHLTLEHARA 336
           G  AA G+V    + L G ++P +  G     ++E+   LS AL   R  +    +    
Sbjct: 172 GTSAASGVVIAHAMVLGG-EIPLEQQGRRTKQVDEELLALSQALDACRNTLSALSQRFDG 230

Query: 337 RQHRDEEAIFSAHLALLEDPVLLDAADLFIEQGSAAPHAWSRSIDTQCQVLQQLGSTLLA 396
              ++ ++IFSA   LL+D  L       I+ G  A  A SR         QQ+    + 
Sbjct: 231 ENEKEVQSIFSALQLLLDDTSLGGEYGREIQAGWTAISAVSRVSLRYIDHFQQMQDPYMQ 290

Query: 397 ERANDLRDLRQRVLRVLLG-EAWQFDVAAGAIVAAQELTPSDLLQLSAQGVAGVCMVEGG 455
           ERA D+RDL QRVLR L+  +  Q ++    I+  +E T + L +     + G+    GG
Sbjct: 291 ERATDIRDLGQRVLRELIEPQKMQLELDVPVILVTKEATATMLAEFPQHKLVGIVTELGG 350

Query: 456 ATSHVAILARGKGLPCLVALGDELLAQEQGQAVVLDADGGRLELTPTVERLAQVRQAQTR 515
             SH AILAR  G+P ++ +   L A   G+ ++L+A+ G++ ++PT   + + R   + 
Sbjct: 351 VNSHAAILARAFGVPAVIGVEGILNAGIDGKQLILNANRGQVLISPTPTLIGEYRSLISA 410

Query: 516 RTALRAQQQSLAHTPARTVDGVEVEVAANVASSAEAGESLANGADGVGLLRTEFLFVDRH 575
             AL+ +       PA T+D   + +  N    +     +A GADGVGL RTE  F+ + 
Sbjct: 411 EKALQKRYAEELSKPAMTLDERRIHLYLNAGLLSSLASEIAEGADGVGLYRTEIPFMLQT 470

Query: 576 TAPDEEEQRQAYQAVLEAMGDKPVIIRTIDVGGDKQLDYLPLPSEANPVLGLRGIRLAQV 635
             P E EQ + Y+ VL A   +PV++RT+DVGGDK L YLP+  E NP LG RGIRL   
Sbjct: 471 RFPSEAEQVEVYRQVLNAALGRPVVMRTLDVGGDKPLSYLPI-IEENPFLGWRGIRLTLD 529

Query: 636 RPDLLDQQLRALLQ-TRPLDRCRILLPMVTEVDELLHIRKRLDALGSELGLS-----ERP 689
            P+L   QLRA+L  +   ++  ILLPMV  +DE+      L+    E+        +RP
Sbjct: 530 HPELFLVQLRAMLNASGGGEQLHILLPMVCCLDEIDQAIAYLEQAYLEVKQDVHPDLQRP 589

Query: 690 QLGVMVEVPAAALLAEQLAEHADFLSIGTNDLSQYTLAMDRDHAGLAARVDALHPALLRL 749
           ++G+M+EVPA     E++A+  DF+S+G+NDL+QY LA+DR++  ++   D+ HP +LR 
Sbjct: 590 KIGIMLEVPALLFQLEEVAKRVDFISVGSNDLTQYLLAVDRNNPRVSTLYDSYHPGILRA 649

Query: 750 IAQTCAGAAKHGRWVGVCGALASDPLATPVLIGLGVRELSVSPPQIGEIKDRVRHLDAAQ 809
           + Q      ++   + VCG LA +P+   +L+ +G  +LS++   + +I   +R +    
Sbjct: 650 LTQARLACREYRLPISVCGELAGEPMGVLLLVAMGYTQLSMNQGSLAKINYLIRRVSYQD 709

Query: 810 CARLSNELLNLGSALAVR 827
            + L  + L+L +   VR
Sbjct: 710 LSELLAQALSLTNGFEVR 727


Lambda     K      H
   0.319    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1055
Number of extensions: 46
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 837
Length of database: 743
Length adjustment: 41
Effective length of query: 796
Effective length of database: 702
Effective search space:   558792
Effective search space used:   558792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory