GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gltS in Shewanella loihica PV-4

Align Sodium/glutamate symporter; Glutamate permease (characterized)
to candidate 5207569 Shew_0103 sodium/glutamate symporter (RefSeq)

Query= SwissProt::P0AER8
         (401 letters)



>lcl|FitnessBrowser__PV4:5207569 Shew_0103 sodium/glutamate
           symporter (RefSeq)
          Length = 407

 Score =  353 bits (905), Expect = e-102
 Identities = 188/405 (46%), Positives = 276/405 (68%), Gaps = 16/405 (3%)

Query: 1   MFHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEV 60
           ++ +  L + + A L L +G  +   V+  +KY IPEP+ GGLLVA  + +L  S    +
Sbjct: 4   VYTVGELESFLVAILVLFIGHSVNRHVASFRKYNIPEPIVGGLLVAAVITILH-SYNISL 62

Query: 61  NFDMSLRDPLMLAFFATIGLNANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLG 120
            F +S+++ LML FF+++GL A+   L  GG  V +FL +    +++QNA+G+ MA+ LG
Sbjct: 63  EFSLSMQNTLMLMFFSSVGLAASYKLLMKGGSKVFLFLAIASLYIIIQNAVGVSMATALG 122

Query: 121 LDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFTNATEVAMACATFGLVLGGLIGGPVA 180
           L+PLMGL+AGSITLSGGHGTGAAW++ F ++YG  N  E+AMA ATFGLV+GG+IGGPVA
Sbjct: 123 LEPLMGLIAGSITLSGGHGTGAAWAQTFSDQYGI-NTLELAMAAATFGLVMGGIIGGPVA 181

Query: 181 RYLVK-------HSTTPNGIPDDQEVPTAFEKPDVGRMITSLVLIETIALIAICLT---- 229
           + L+        +    N   D  ++ T +++ +  R +T+  ++E + ++ +C+     
Sbjct: 182 QRLINKNGLLSSYGVGGNHHKDHPDLVT-YDQLEEDR-VTAKSILEVLFILLLCVAGAKW 239

Query: 230 VGKIVAQLLAGTAFELPTFVCVLFVGVILSNGLSIMGFYRVFERAVSVLGNVSLSLFLAM 289
            G ++A L  G   ++P FV  LF GV+++N   +   +++    V VLG VSL+LFLAM
Sbjct: 240 FGSLIAYLDIGW-LKMPDFVYALFFGVVITNITEVSRGFKINRECVDVLGTVSLALFLAM 298

Query: 290 ALMGLKLWELASLALPMLAILVVQTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGA 349
           ALM LKLWE+  LA+P+L IL+VQT  +A++A +VT+++MG NYDAAV+A GHCGFGLGA
Sbjct: 299 ALMNLKLWEIFDLAVPLLIILLVQTAVLAVFAYWVTFKLMGANYDAAVMAGGHCGFGLGA 358

Query: 350 TPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKLYL 394
           TPTA+ NM A+  R GPS  AF+VVP+VGAFFIDIVNA++++ YL
Sbjct: 359 TPTAVMNMGALVSRTGPSPQAFMVVPIVGAFFIDIVNAIILQGYL 403


Lambda     K      H
   0.329    0.143    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 379
Number of extensions: 19
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 407
Length adjustment: 31
Effective length of query: 370
Effective length of database: 376
Effective search space:   139120
Effective search space used:   139120
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory