GapMind for catabolism of small carbon sources

 

Aligments for a candidate for gtrB in Shewanella loihica PV-4

Align GtrB aka SLL1103, component of Tripartite glutamate:Na+ symporter (characterized)
to candidate 5208943 Shew_1444 TRAP dicarboxylate transporter, DctM subunit (RefSeq)

Query= TCDB::P74224
         (445 letters)



>lcl|FitnessBrowser__PV4:5208943 Shew_1444 TRAP dicarboxylate
           transporter, DctM subunit (RefSeq)
          Length = 465

 Score =  195 bits (496), Expect = 2e-54
 Identities = 139/473 (29%), Positives = 229/473 (48%), Gaps = 65/473 (13%)

Query: 11  MFVGALVFLGCGYPVAFSLGGVAILFAIIGAALGSFDPIFLSAMPQRIF-GIMANGTLLA 69
           +F+   + +  G P+A +LG  ++L  ++      F    L+++  +++     + TLLA
Sbjct: 6   LFISLFLCMLLGMPIAIALGFSSMLTILL------FSDDSLASVALKLYESTSEHYTLLA 59

Query: 70  IPFFIFLGSMLERSGIAEQLLETMGIILGHLRGGLALAVILVGTMLAATTGVVAATVVAM 129
           IPFFI   + L   G+A ++++     +GH+RGGLA+A ++   + AA +G   ATV A+
Sbjct: 60  IPFFILSSAFLSTGGVARRIIDFAMDSVGHIRGGLAMASVMACMLFAAVSGSSPATVAAI 119

Query: 130 GLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQLGVSVGDLFIGSLLPG 189
           G I +  M+R GY ++ A+GVI  SGTLG +IPPS+V++V A    VS   +F+  L+PG
Sbjct: 120 GSIVIVGMVRAGYPEKFAAGVITTSGTLGILIPPSIVMLVYAAATEVSAARMFMAGLIPG 179

Query: 190 LMMAGSFALYVLIIAWLK-------PDLAPALPAEVRNIGGQELRRRIVQVMLPPLVLIL 242
           LMM     L + I+A +K       P   P   +  + +GG              L LI+
Sbjct: 180 LMMGLLLMLAIYIVARIKKLPSRPFPGFRPLAISSAKAMGG--------------LALIV 225

Query: 243 LVLGSIFFGIASPTEAGAVGSIGAIALAHFNQR-------LNW----------------- 278
           +VLGSI+ GIASPTEA AV  + A  +A F  R       ++W                 
Sbjct: 226 IVLGSIYGGIASPTEAAAVACVYAYFIAVFGYRDIGPLKNVSWRDSGEPLIRAILRNLGF 285

Query: 279 -----------KALWEVCDATLRITSMVMLILLGSTAFSLVFRGLEGDRFMFDLLANLPG 327
                      K +  V     +++ M++ I+  +  F+ V         + + +  +  
Sbjct: 286 MVLAVFKTPADKEIRHVVRDGAKVSIMLLFIIANAMLFAHVLTTERIPHLIAETIVGMGL 345

Query: 328 GQIGFLAISMITIFILGFFIDFFEIAFIVLPLFKPVAEALNLDLIWYGVIVGANLQTSFL 387
              GFL I  + +   G F++   I  I+ P+  P+A  L +D I  G+I+  N++   L
Sbjct: 346 PVWGFLIIVNLLLLAAGNFMEPSAILLIMAPILFPIATQLGIDPIHLGIIMVVNMEIGML 405

Query: 388 TPPFGFALFYLRGVAPASLTTGQIYRGAVPFIGLQVLVLLLIIIFPALINWLP 440
           TPP G  LF   G+   S+  G +    +P++ L +  L LI   P +  +LP
Sbjct: 406 TPPVGLNLFVTAGITGRSM--GWVIHSCIPWLALLLFFLALITYIPQISLFLP 456


Lambda     K      H
   0.331    0.148    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 498
Number of extensions: 22
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 445
Length of database: 465
Length adjustment: 33
Effective length of query: 412
Effective length of database: 432
Effective search space:   177984
Effective search space used:   177984
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory