Align ABC transporter for Glycerol, ATPase component 1 (characterized)
to candidate 5207560 Shew_0094 ABC transporter-related protein (RefSeq)
Query= reanno::acidovorax_3H11:Ac3H11_791 (363 letters) >FitnessBrowser__PV4:5207560 Length = 369 Score = 116 bits (290), Expect = 1e-30 Identities = 80/238 (33%), Positives = 120/238 (50%), Gaps = 8/238 (3%) Query: 20 DMSLALQSGAVTVLLGATQAGKTSLMRIMAGLDAPTAGRVTV------DGKDVTGMPVRD 73 D ++G V ++G + GK++LMR++AGL P +G + + + + Sbjct: 21 DAEFVCKAGEVLAVVGPSGGGKSTLMRMIAGLTKPESGEIRYGDSVWFSSESGRYLTPQQ 80 Query: 74 RNVAMVYQQFINYPSMKVAANIASPLKLRGEKNIDARVREIASRLHIDMFLDRYPAELSG 133 R++ V Q F +P+M AN+ + L + AR ++ R+++ DR PA LSG Sbjct: 81 RHLGYVPQHFGLFPNMTALANVVAALDHIPKAERVARAKDWLERVNLHGLPDRLPANLSG 140 Query: 134 GQQQRVALARALAKGAPLMLLDEPLVNLDYKLREELREELTQLFAAGQSTVVYATTEPGE 193 GQ+QRVALARALA+ ++LLDEP +D + RE L EL +L V+ T + E Sbjct: 141 GQRQRVALARALAREPRVLLLDEPFSAVDRETRERLYLELARLKEQLAIPVIMVTHDLNE 200 Query: 194 ALLLGGYTAVLDEGQLLQYGPTAEVFHAPNSLRVARAFSDPPMNLMAASATAQGVRLQ 251 ALLL ++ +G LLQ G EV P + VA+ NL A AQ Q Sbjct: 201 ALLLADRMILISQGTLLQQGSPREVLSRPRNEAVAKQMG--LRNLFDAHVVAQEAERQ 256 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 369 Length adjustment: 30 Effective length of query: 333 Effective length of database: 339 Effective search space: 112887 Effective search space used: 112887 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory