Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 5209137 Shew_1615 ABC transporter-related protein (RefSeq)
Query= uniprot:Q1MCU2 (292 letters) >FitnessBrowser__PV4:5209137 Length = 301 Score = 101 bits (252), Expect = 2e-26 Identities = 76/238 (31%), Positives = 116/238 (48%), Gaps = 36/238 (15%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMI-T 72 L+ + LS +FG A+ND + E G AL+GPNGAGKTT+F+ + G+ +PT G + Sbjct: 3 LITCKALSKQFGSKRALNDINLELSAGQPIALVGPNGAGKTTLFSLLCGYIRPTEGAVEI 62 Query: 73 FNQKSGKQYLLERLPDFRITKEARVARTFQNIRLFSGLTVLENL-LVAQHNKLMKASGYT 131 G LL +VA Q+ RL LT+ L L AQ AS Sbjct: 63 LGHAPGSTALL-----------GKVAALPQDARLDPNLTIAAQLELFAQLQGFNAASA-- 109 Query: 132 ILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGPE 191 +RE + L DL + A L +G +R+ IA+A+ PE Sbjct: 110 ----------RRECQRVLAL-------VDLAEVAAQKPSSLSHGMSKRVSIAQALIGSPE 152 Query: 192 LLCLDEPAAGLNPRESATLNALLKSIRAETG-TSILLIEHDMSVVMEISDHVVVLEYG 248 L+ LDEP AGL+P A A+ + +RA+ G T+ ++ H+++ + ++ D V+ L+ G Sbjct: 153 LVLLDEPTAGLDP---ANAKAIRELVRAQIGKTTFVISSHNLAELEKLCDKVLYLDKG 207 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 161 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 301 Length adjustment: 26 Effective length of query: 266 Effective length of database: 275 Effective search space: 73150 Effective search space used: 73150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory