Align 3-ketoacyl-CoA thiolase; Acetyl-CoA acyltransferase; Beta-ketothiolase; EC 2.3.1.16 (characterized)
to candidate 5210417 Shew_2858 acetyl-CoA acetyltransferase (RefSeq)
Query= SwissProt::O32177 (391 letters) >FitnessBrowser__PV4:5210417 Length = 394 Score = 315 bits (808), Expect = 1e-90 Identities = 182/394 (46%), Positives = 242/394 (61%), Gaps = 5/394 (1%) Query: 1 MKEAVIVSGARTPVGKAKKGSLATVRPDDLGAICVKETLKRAGGYEGNIDDLIIGCATPE 60 M+EAVIVS ART + K+ +GSL + + C+K+ ++RAG G IDD I+G Sbjct: 1 MREAVIVSTARTGMAKSFRGSLNNTKSPTMLGHCIKQAVQRAGVEGGEIDDAIMGTVLTA 60 Query: 61 AEQGLNMARNIGALAGLPYTVPAITVNRYCSSGLQSIAYAAEKIMLGAYDTAIAGGAESM 120 G+N+ARN AGLP TV A T++R CSSGL +I AA++I++ +AGG E++ Sbjct: 61 GTAGMNIARNAVLAAGLPNTVSAQTIDRQCSSGLMAIGMAAKQIIVDQQQIVVAGGQENI 120 Query: 121 SQVP---MMGHVTRPNLALAEKAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQNAA 177 + V M + + + P YM M TAE VAK YGVSRE QD +A+ S Q A Sbjct: 121 TAVQNEYMKWAADNADPNVMQFEPHAYMPMLKTAEHVAKVYGVSREAQDIYALMSQQRTA 180 Query: 178 KALAEGKFKDEIVPVEVTVTEIGEDHKPME-KQFVFSQDEGVRPQTTADILSTLRPAFSV 236 A G F DEIVP T+ + K + +Q +DE RP TT + L L P Sbjct: 181 AAQEAGYFDDEIVPFTTTMAIQDRETKAISYQQVTLDRDECNRPSTTMESLQNLAPVIE- 239 Query: 237 DGTVTAGNSSQTSDGAAAVMLMDREKADALGLAPLVKFRSFAVGGVPPEVMGIGPVEAIP 296 G +TAGN+SQ SDGA+A ++M+R+ A+ GLAPL +R AV G PE MGIGP+ AIP Sbjct: 240 GGFITAGNASQLSDGASACVVMERKLAEQRGLAPLGIYRGIAVAGCAPEEMGIGPIYAIP 299 Query: 297 RALKLAGLQLQDIGLFELNEAFASQAIQVIRELGIDEEKVNVNGGAIALGHPLGCTGTKL 356 + LK GL + DIGL+E+NEAFA QA+ LGID + NVNGG I++GHP G TG++L Sbjct: 300 KLLKQHGLTIDDIGLWEINEAFAVQALYCRDHLGIDPARYNVNGGGISIGHPYGMTGSRL 359 Query: 357 TLSLIHEMKRRNEQFGVVTMCIGGGMGAAGVFEL 390 + E KRR ++ VV MCIGGGMGAAG+FE+ Sbjct: 360 VGHALIEGKRRGVKYVVVGMCIGGGMGAAGLFEV 393 Lambda K H 0.316 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 391 Length of database: 394 Length adjustment: 31 Effective length of query: 360 Effective length of database: 363 Effective search space: 130680 Effective search space used: 130680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 5210417 Shew_2858 (acetyl-CoA acetyltransferase (RefSeq))
to HMM TIGR01930 (acetyl-CoA C-acyltransferase (EC 2.3.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01930.hmm # target sequence database: /tmp/gapView.29457.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01930 [M=385] Accession: TIGR01930 Description: AcCoA-C-Actrans: acetyl-CoA C-acyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-125 403.6 6.2 4.8e-125 403.4 6.2 1.0 1 lcl|FitnessBrowser__PV4:5210417 Shew_2858 acetyl-CoA acetyltrans Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210417 Shew_2858 acetyl-CoA acetyltransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 403.4 6.2 4.8e-125 4.8e-125 1 385 [] 6 392 .. 6 392 .. 0.96 Alignments for each domain: == domain 1 score: 403.4 bits; conditional E-value: 4.8e-125 TIGR01930 1 ivdavRtpig.klggslkelsaedLlaavikelleragldpekidevilGnvlqageq.aniaReaalaaglpesvpa 76 iv+++Rt ++ +++gsl+++++ ++l + ik++++rag++ +id++i+G+vl+ag+ +niaR+a+laaglp++v+a lcl|FitnessBrowser__PV4:5210417 6 IVSTARTGMAkSFRGSLNNTKSPTMLGHCIKQAVQRAGVEGGEIDDAIMGTVLTAGTAgMNIARNAVLAAGLPNTVSA 83 89********99****************************************************************** PP TIGR01930 77 ltvnrvCaSglqAvalaaqkikaGeadvvvaGGvEsmSrvpillkaslrreslklgkakledqllkdlvktklsmget 154 t++r+C+Sgl A+ +aa++i + ++++vvaGG E+++ v ++ ++++++++ ++ e ++ ++m +t lcl|FitnessBrowser__PV4:5210417 84 QTIDRQCSSGLMAIGMAAKQIIVDQQQIVVAGGQENITAVQNEYMK-WAADNADPNVMQFEP-------HAYMPMLKT 153 **************************************99866555.367777776666666.......7889***** PP TIGR01930 155 AenlakkygisReeqDeyalrShqkaakAieegkfkdeivpvevkgk............kkvvskDegirpnttlekL 220 Ae++ak yg+sRe qD yal S+q++a+A+e+g+f+deivp++ + ++++++De+ rp tt+e+L lcl|FitnessBrowser__PV4:5210417 154 AEHVAKVYGVSREAQDIYALMSQQRTAAAQEAGYFDDEIVPFTTTMAiqdretkaisyqQVTLDRDECNRPSTTMESL 231 *****************************************9988778889*******999***************** PP TIGR01930 221 akLkpafkekkgstvtAgNssqlnDGAaalllmseevakelgltplarivsaavagvdpeemglgpvpAiekaLkkag 298 ++L p+ + g +tAgN+sql+DGA+a ++m+++ a++ gl pl+ ++++avag+ peemg+gp++Ai+k+Lk++g lcl|FitnessBrowser__PV4:5210417 232 QNLAPVIE--GG-FITAGNASQLSDGASACVVMERKLAEQRGLAPLGIYRGIAVAGCAPEEMGIGPIYAIPKLLKQHG 306 *******7..58.6**************************************************************** PP TIGR01930 299 lsisdidlvEinEAFAaqvlavekelgsldlekvNvnGGAiAlGHPlGasGarivltllkeLkergkkyGlatlCvgg 376 l+i+di l+EinEAFA+q+l+++++lg +d++++NvnGG i++GHP+G++G+r+v + l e k+rg+ky ++ +C+gg lcl|FitnessBrowser__PV4:5210417 307 LTIDDIGLWEINEAFAVQALYCRDHLG-IDPARYNVNGGGISIGHPYGMTGSRLVGHALIEGKRRGVKYVVVGMCIGG 383 ***************************.88************************************************ PP TIGR01930 377 GqGaAvile 385 G+GaA ++e lcl|FitnessBrowser__PV4:5210417 384 GMGAAGLFE 392 *****9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (394 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.41 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory