Align High-affinity branched-chain amino acid transport ATP-binding protein LivG aka B3455, component of Leucine; leucine/isoleucine/valine porter (characterized)
to candidate 5208200 Shew_0712 ABC transporter-related protein (RefSeq)
Query= TCDB::P0A9S7 (255 letters) >FitnessBrowser__PV4:5208200 Length = 324 Score = 112 bits (279), Expect = 1e-29 Identities = 78/250 (31%), Positives = 132/250 (52%), Gaps = 16/250 (6%) Query: 2 SQPLLSVNGLMMRFGGLLAVNNVNLELYPQEIVSLIGPNGAGKTTVFNCLTGFYKPTGGT 61 ++P LSV L R G ++ V L+L +++ +IGPNGAGK+++ CL F P+ G Sbjct: 32 ARPALSVRDLSWRCGERAILSGVKLDLPEGKMLGIIGPNGAGKSSLLRCLYRFLTPSSGE 91 Query: 62 ILLRDQHLEGLPGQQIARMGVVRTFQHVRLFREMTVIENLLVAQHQQLKTGLFSGLLKTP 121 I L Q + L + AR V Q +MT + LVA FS + T Sbjct: 92 IQLFGQPIASLSARAFAR-EVAVVLQDTPQHFDMTTAQ--LVALGLTPHKAAFS--MTTK 146 Query: 122 SFRRAQSEALDRAATWLERIGLLEHANRQASNLAYGDQRRLEIARCMVTQPEILMLDEPA 181 + R A S+A LE +GL E A + ++L+ G+++R IAR + QP++L+LDEP Sbjct: 147 ADRLAVSQA-------LETVGLKERAGQTYASLSGGEKQRALIARAIAQQPKLLILDEPT 199 Query: 182 AGLNPKETKELDELIAELRNHHNTTILLIEHDMKLVMGISDRIYVVNQGTPLANGTPEQI 241 L+ + ++ EL+ L T+++ HD+ L + D++ +++QG +A G+P+Q+ Sbjct: 200 NHLDIRYQIQILELLKAL----GVTVVISIHDLNLASALCDQLLLLDQGKAVAQGSPKQV 255 Query: 242 RNNPDVIRAY 251 + + R + Sbjct: 256 LSEAQIARVF 265 Lambda K H 0.320 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 199 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 324 Length adjustment: 26 Effective length of query: 229 Effective length of database: 298 Effective search space: 68242 Effective search space used: 68242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory