Align Branched-chain amino acid ABC transporter permease LivH; SubName: Full=Branched-chain amino acid transporter permease subunit LivH; SubName: Full=L-leucine ABC transporter membrane protein /L-isoleucine ABC transporter membrane protein /L-valine ABC transporter membrane protein (characterized, see rationale)
to candidate 5210165 Shew_2609 inner-membrane translocator (RefSeq)
Query= uniprot:A0A0D9B2B6 (307 letters) >FitnessBrowser__PV4:5210165 Length = 297 Score = 135 bits (339), Expect = 2e-36 Identities = 89/305 (29%), Positives = 162/305 (53%), Gaps = 21/305 (6%) Query: 9 QQLVNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVAFIAIAGLAMMGLDSV 68 Q ++NGL VG Y ++ + + +VY ++NFA GE ++G++V + A + + Sbjct: 8 QLIINGLIVGLLYGVVGMCFVLVYKSTQIVNFAQGEFLLVGAWVCW------AFLTYFQL 61 Query: 69 PLLMTAAFIASIVVTSSYGYSIERIAYRPLRGSNRLIPLISAIGMSIFLQNTVLLSQDSK 128 P + F+ ++ + +G ++ I RP+ G + ++ IG+SIF Q+ Sbjct: 62 PFFV--GFLFTLCFMAVFGVLLQMIVLRPMIGEPIISVIMVTIGLSIFFQSLTKWIFGVS 119 Query: 129 DKSIPNLIPGNFAIGPGGAHEVLISYMQIVVFVVTLVAMLGLTLFISRSRLGRACRACAE 188 +S P + +I G + L M V+ ++ + A LF S+ G A RA A Sbjct: 120 PQSYPQVFDTQ-SIAIFGLNIELAYLMSTVIAILIMAAFF---LFFKYSKHGLAMRATAF 175 Query: 189 DIKMANLLGINTNNIIALTFVIGAALAAIAAVLLSMQYGVINPNAGFLVGLKAFTAAVLG 248 D ++A LGI+ + A+++ I A ++A A V++ M GV + + +G+K F A +LG Sbjct: 176 DQQVAQSLGISVKQVFAMSWGIAATVSATAGVVIGMVNGVSDSLS--TIGIKVFPAVILG 233 Query: 249 GIGSIPGAMLGGLVLGVAEAFGADIFGDQY------KDVVAFGLLVLVLLFRPTGILGRP 302 G+ SI GA++GG+V+GV E A+ F Q+ D+ F +L+++L F+P G+ G Sbjct: 234 GLDSIVGAIVGGVVIGVLENI-AEFFDSQWLHIGNMYDIAPFYVLLVILWFKPYGLFGTR 292 Query: 303 EVEKV 307 ++E++ Sbjct: 293 DIERI 297 Lambda K H 0.327 0.144 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 248 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 297 Length adjustment: 27 Effective length of query: 280 Effective length of database: 270 Effective search space: 75600 Effective search space used: 75600 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory