Align Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit; PCC; EC 6.4.1.3; EC 6.3.4.14 (characterized)
to candidate 5210939 Shew_3365 acetyl-CoA carboxylase, biotin carboxylase (RefSeq)
Query= SwissProt::I3R7G3 (601 letters) >FitnessBrowser__PV4:5210939 Length = 450 Score = 434 bits (1115), Expect = e-126 Identities = 222/448 (49%), Positives = 300/448 (66%), Gaps = 2/448 (0%) Query: 2 FSKVLVANRGEIAVRVMRACEELGVRTVAVYSEADKHGGHVRYADEAYNIGPARAADSYL 61 F KVLVANRGEIA+R++RAC +LG++TVA+YS ADK GH+R AD+ IGPA A +SYL Sbjct: 4 FDKVLVANRGEIALRIIRACRQLGIKTVALYSSADKDSGHLRLADQQICIGPAPAKESYL 63 Query: 62 DHESVIEAARKADADAIHPGYGFLAENAEFARKVEDSEFTWVGPSADAMERLGEKTKARS 121 + +++ AA A DAIHPGYGFLAENA+FA++V DS F ++GP AD + +G+K A + Sbjct: 64 NIAAILGAADLARVDAIHPGYGFLAENADFAQQVTDSGFHFIGPKADTIRLMGDKVSAIA 123 Query: 122 LMQDADVPVVPGTTEP-ADSAEDVKAVADDYGYPVAIKAEGGGGGRGLKVVHSEDEVDGQ 180 M+ A VP VPG+ D+ +A GYP+ IKA GGGG+G++VV E ++ G Sbjct: 124 AMKAAGVPTVPGSDGLLGDNEAQSLEIAAQIGYPLIIKATAGGGGKGMRVVEDEAQLLGA 183 Query: 181 FETAKREGEAYFDNASVYVEKYLEAPRHIEVQILADEHGNVRHLGERDCSLQRRHQKVIE 240 ++E EA F N VY+EKYL PRHIEVQ+L D G+ LGERDCSLQR QKVIE Sbjct: 184 IALTRQEAEAAFGNGGVYLEKYLTRPRHIEVQVLCDHQGHCISLGERDCSLQRAQQKVIE 243 Query: 241 EAPSPALSEDLRERIGEAARRGVRAAEYTNAGTVEFLVEDGEFYFMEVNTRIQVEHTVTE 300 AP+P L+ + R++I E+ R +A Y AGT+EFL +DGEFYFME+NTRIQVEHT++E Sbjct: 244 SAPAPGLTPEQRQQISESCIRACQAIGYRGAGTLEFLYQDGEFYFMEMNTRIQVEHTISE 303 Query: 301 EVTGLDVVKWQLRVAAGEELDFSQDDVEIEGHSMEFRINAEAPEKEFAPATGTLSTYDPP 360 VTG+D++ QLRVA GE L + ++ +GH++E RINAE P FAP+ G + P Sbjct: 304 MVTGVDLLVLQLRVAQGEPLALQESLIQPKGHAIECRINAEDP-ASFAPSPGRIDRLVVP 362 Query: 361 GGIGIRMDDAVRQGDEIGGDYDSMIAKLIVTGSDREEVLVRAERALNEFDIEGLRTVIPF 420 GG+G+R + + G + YD+MIAKLI G DR + + R AL+E I G++T +P Sbjct: 363 GGLGVRWESHLSPGAHVPPQYDAMIAKLIAWGDDRAQAIARMRTALDELTITGIKTNVPL 422 Query: 421 HRLMLTDEAFREGSHTTKYLDEVLDPER 448 R +L D ++G + YL+E P R Sbjct: 423 LRALLADPQVQQGETSIHYLEETFLPRR 450 Lambda K H 0.312 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 648 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 601 Length of database: 450 Length adjustment: 35 Effective length of query: 566 Effective length of database: 415 Effective search space: 234890 Effective search space used: 234890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory