Align UDP-glucose-hexose-1-phosphate uridylyltransferase (EC 2.7.7.12) (characterized)
to candidate 5209835 Shew_2288 galactose-1-phosphate uridylyltransferase (RefSeq)
Query= BRENDA::P09148 (348 letters) >FitnessBrowser__PV4:5209835 Length = 363 Score = 437 bits (1125), Expect = e-127 Identities = 200/345 (57%), Positives = 253/345 (73%), Gaps = 1/345 (0%) Query: 2 TQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRV 61 +QF+ +HPHRR+NPLTG+W+L+SPHR+KRPWQG E P++D +CFLC GN R+ Sbjct: 9 SQFSTDEHPHRRFNPLTGEWVLLSPHRSKRPWQGQTEALDLTTAPSYDSECFLCPGNKRI 68 Query: 62 TGDKNPDYTGTYVFTNDFAALMSDTPDAPESHDPLMRCQSARGTSRVICFSPDHSKTLPE 121 G++NP Y T+VF NDFAAL SD P A + DPL R ++ G SRV+CFSPDHS TL + Sbjct: 69 NGEQNPKYDTTFVFQNDFAALNSDGPKA-QGEDPLFRFETVEGESRVLCFSPDHSLTLAQ 127 Query: 122 LSVAALTEIVKTWQEQTAELGKTYPWVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAER 181 L A+ ++ WQ Q+ LGK Y WVQVFENKGAAMGCSNPHPHGQIWA++ LP Sbjct: 128 LDPEAMQAVIAAWQSQSELLGKKYLWVQVFENKGAAMGCSNPHPHGQIWAHNHLPTLVAT 187 Query: 182 EDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYWAAWPFETLLLPKAHV 241 + + +Y+ + S +L DYV+REL R VV W+A+VPYWA+WPFETL+LP+ + Sbjct: 188 KQQRLADYYQQHHSNLLGDYVERELQQEVRIVVSNHDWVALVPYWASWPFETLVLPRFDI 247 Query: 242 LRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFNGEENQHWQLHAHFYP 301 R+T+LT R L + LT RYDNLFQC+FPYSMGWHGAPF+G+++ W LHAHFYP Sbjct: 248 RRMTELTAETRESLGEIIGALTVRYDNLFQCAFPYSMGWHGAPFDGQDHPEWCLHAHFYP 307 Query: 302 PLLRSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVSDIHFRES 346 PLLRSA+V+KFMVGYE+LAE QRD+T EQAA RLR S IH++ S Sbjct: 308 PLLRSASVKKFMVGYELLAEIQRDITPEQAAARLREQSPIHYKSS 352 Lambda K H 0.319 0.133 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 363 Length adjustment: 29 Effective length of query: 319 Effective length of database: 334 Effective search space: 106546 Effective search space used: 106546 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory