Align ABC transporter for Lactose, ATPase component (characterized)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 197 bits (500), Expect = 4e-55 Identities = 112/294 (38%), Positives = 173/294 (58%), Gaps = 12/294 (4%) Query: 1 MSELQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDL 60 MS L + V Y G +++G+DL + GE +GPSGCGK+TLL+ IAGL+ IS G + Sbjct: 1 MSTLTIEQVHSDYQGQTILRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRI 60 Query: 61 TIDDVRMND----VDPSKRGIAMVFQSYALYPHMTVRENMGFALRFAGVPRAEIEKRVNE 116 +I+ ++ V +R + M+FQ YAL+PH+TV EN+ F ++ G+ +A + R+ E Sbjct: 61 SINGRLLSGPETFVPSERREVGMIFQDYALFPHLTVAENILFGVK--GLDKAARQARLGE 118 Query: 117 AAHILELGALLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIEI 176 +++L L R P +LSGGQ+QRV+I RA+ P++ L DEP SN+DA++R M +EI Sbjct: 119 MLALVKLEGLGGRYPHELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEI 178 Query: 177 ARLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDPANLFVAGFIGS 236 + KQ + V+VTH + EA ADK+ + + G + Q GS LY +P + +VA F+G Sbjct: 179 REILKQRGVSAVFVTHSKDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLG- 237 Query: 237 PKMNFLKGVIEIDEDQAYARLPDYGDAKIPVTLQAAAGTAVTIGIRPEHFDEAG 290 ++N+L E+ + L G+ + L AAG + +RPE AG Sbjct: 238 -QVNYLS--CEVKDRARLQTL--LGEVQSSSDLPKAAGYRGELLLRPEQLQMAG 286 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 342 Length adjustment: 29 Effective length of query: 329 Effective length of database: 313 Effective search space: 102977 Effective search space used: 102977 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory