Align ABC transporter for Lactose, ATPase component (characterized)
to candidate 5210736 Shew_3164 ABC transporter-related protein (RefSeq)
Query= reanno::Smeli:SM_b20002 (358 letters) >FitnessBrowser__PV4:5210736 Length = 241 Score = 140 bits (352), Expect = 4e-38 Identities = 84/230 (36%), Positives = 136/230 (59%), Gaps = 12/230 (5%) Query: 4 LQLSDVRKSYGGLEVIKGVDLDIKSGEFVVFVGPSGCGKSTLLRMIAGLEEISSGDLTID 63 +++S++ K +G +V+KG+D I GE V +GPSG GKST LR I LE+ + G++ ID Sbjct: 2 IKISNLHKYFGDNQVLKGIDESIARGEVVSVIGPSGSGKSTFLRCINLLEQPTQGEIVID 61 Query: 64 DVRMND----VDPSKRGIAMVFQSYALYPHMTVRENMGFA-LRFAGVPRAEIEKRVNEAA 118 + +D ++ + MVFQ++ L+PH TV++N+ A ++ + +AE + +EA Sbjct: 62 GQSITAPDACIDKLRQKVGMVFQNFNLFPHKTVQQNITLAPVKLGLMTQAEAD---SEAM 118 Query: 119 HILELGALLDRK---PKQLSGGQRQRVAIGRAIVRHPKIFLFDEPLSNLDAELRVHMRIE 175 +L+ L D+ P LSGGQ+QRVAI RA+ P++ LFDEP S LD E+ V ++ Sbjct: 119 RLLDQVGLSDKASAYPASLSGGQKQRVAIARALAMKPELMLFDEPTSALDPEM-VGDVLD 177 Query: 176 IARLHKQLATTIVYVTHDQVEAMTLADKIVVMRAGVVEQVGSPLDLYDDP 225 + + Q T+V VTH+ A ++D+++ M G V + P L+ P Sbjct: 178 VMKQLAQAGMTMVIVTHEMGFAKDVSDRVIFMDGGYVVESNVPALLFGQP 227 Lambda K H 0.321 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 358 Length of database: 241 Length adjustment: 26 Effective length of query: 332 Effective length of database: 215 Effective search space: 71380 Effective search space used: 71380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory