Align phosphomannose mutase (EC 5.4.2.8) (characterized)
to candidate 5210391 Shew_2832 phosphoglucosamine mutase (RefSeq)
Query= metacyc::MONOMER-13382 (455 letters) >FitnessBrowser__PV4:5210391 Length = 443 Score = 211 bits (538), Expect = 3e-59 Identities = 154/460 (33%), Positives = 235/460 (51%), Gaps = 29/460 (6%) Query: 1 MGKLFGTFGVRG-IANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKE 59 M K FGT G+RG + K+TPE A+K+G A G +L R G KK V++G+DTR+SG + + Sbjct: 1 MRKFFGTDGIRGKVGAGKMTPELALKLGWAAGRVLSRTGTKK--VIIGKDTRISGYLFES 58 Query: 60 ALISGLLSVGCDVIDVGIAPTPAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMG 119 A+ +GL + G +V+ +G PTPAV + T+ F A+ G VI+ASHNP NGIK +G Sbjct: 59 AMEAGLSAAGLNVMLMGPMPTPAVAYLTRTFRAEAGVVISASHNPYYDNGIKFFSTDGSK 118 Query: 120 LKKEREAIVEELFFKEDFDRAKWYEIGEVRR-EDIIKPYIEAIKSKVDVE-AIKKRKPFV 177 L E E +E ++ + + + +G+V R ED YIE K E + K + Sbjct: 119 LDDEVELEIER-ELEKPLECVESHLLGKVSRIEDAAGRYIEYCKGNFPAEHTLNGLK--I 175 Query: 178 VVDTSNGAGSLTLPYLLRELGCKVITVNAQPDGYFPARNPEPNEENLKEFMEIVKALGAD 237 VVD ++GA P + RELG +VIT+ +PDG N E ++ + E V A AD Sbjct: 176 VVDCAHGATYHIAPSVFRELGAEVITIGDKPDGI--NINHEVGATSMGKIRETVIAEKAD 233 Query: 238 FGVAQDGDADRAVFIDENGRFIQGDK-TFALVADAVLKEKGGGLLVTTVATSNLLDDIAK 296 G+A DGD DR + ++ +G+ I GD+ + L DA + G +V T+ ++ LD K Sbjct: 234 LGIALDGDGDRIMMVNRHGKVIDGDEILYILACDAQDRGVLKGGVVGTLMSNLGLDLALK 293 Query: 297 KHGAKVMRTKVGDLIVARALYENNGTIGGEENGGVIFPEHVLGRDGAMTVAKVVEIFAKS 356 R+KVGD V L E + IGGE +G ++ +H DG + V+ + Sbjct: 294 ARDIPFARSKVGDRYVMELLKEKDWRIGGENSGHILNLDHGTTGDGIVAGILVLAAMCRK 353 Query: 357 GKKFSELIDELPKYYQIKTKRHVEG-----DRHAIVNKVAEMARERGYTVDTTDGAKIIF 411 EL + + Q+ EG + ++++ AE+ + G Sbjct: 354 QATLEELTEGIKMLPQVLVNVRFEGTHNPLEADSVLSAQAEVEAKLG------------- 400 Query: 412 EDGWVLVRASGTEPIIRIFSEAKSKEKAQEYLNLGIELLE 451 E G VL+R SGTEP+IR+ E + + N E ++ Sbjct: 401 ERGRVLLRKSGTEPLIRVMVEGDVASDVKAHANYIAEAIK 440 Lambda K H 0.317 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 519 Number of extensions: 30 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 455 Length of database: 443 Length adjustment: 33 Effective length of query: 422 Effective length of database: 410 Effective search space: 173020 Effective search space used: 173020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory