Align The amino acid (leucine):2 Na+ symporter, LeuTAa (Yamashita et al., 2005). LeuT possesses two ion binding sites, NA1 and NA2, both highly specific for Na+ but with differing mechanisms of binding (Noskov and Roux, 2008). X-ray structures have been determined for LeuT in substrate-free outward-open and apo inward-open states (characterized)
to candidate 5210455 Shew_2896 sodium:neurotransmitter symporter (RefSeq)
Query= TCDB::O67854 (513 letters) >FitnessBrowser__PV4:5210455 Length = 503 Score = 217 bits (553), Expect = 7e-61 Identities = 152/479 (31%), Positives = 237/479 (49%), Gaps = 49/479 (10%) Query: 3 VKREHWATRLGLILAMAGNAVGLGNFLRFPVQAAENGGGAFMIPYIIAFLLVGIPLMWIE 62 +KRE W +R+G ILA G+A+GLGN RFP A +NGGGAF IPY+ A + GIP M +E Sbjct: 1 MKREQWNSRVGFILAAVGSAIGLGNIWRFPYMAYDNGGGAFFIPYLFAMITAGIPFMIME 60 Query: 63 WAMGRYGGAQGHGTTPAIFYLLWRNRFAKI--LGVFGLWIPLVVAIYYVYIESWTLGFAI 120 +++G + T+P IF L ++ LG F ++I V+A+YYV I WTL + + Sbjct: 61 FSLGH----KIKKTSPRIFAQLGHTLGFRLEWLGWFQVFIAAVIAVYYVAIIGWTLSY-L 115 Query: 121 KFLVGLVPEPPPNATDPDSILRPFKEFLYSYIGVPKGDEP--ILKPSLFAYIVFLITMFI 178 F PN +F +++ + P + + + I I + Sbjct: 116 GFSFSQAWGDNPN------------DFFFNHYLKLGNNSPSHLGEFQIGIAIAMSIAWLM 163 Query: 179 NVSILIRGISKGIERFAKIAMPTLFILAVFLVIRVFLLETPNGTAADGLNFLWTPDFEKL 238 + G+ GIER KI MP LFI+ + L+ R+ L A GLN+L+ PDF +L Sbjct: 164 TFMAVFTGVKGGIERANKIMMPMLFIMVLVLIGRIMFLPG----ALSGLNYLFEPDFSRL 219 Query: 239 KDPGVWIAAVGQIFFTLSLGFGAIITYASYVRKDQDIVLSGLTAATLNEKAEVILGGSIS 298 D VW AA GQIFFTLS+GF ++ Y+SY+ DI N V++ S Sbjct: 220 LDAQVWSAAYGQIFFTLSVGFAIMLAYSSYLPTKADI--------NNNAFMTVLINCGFS 271 Query: 299 IPAAVAFFGVANAVAIAK--------AGAFNLGFITLPAIFSQTAGGTFLGFLWFFLLFF 350 I A + FGV +A + + L F+T+P + LG L+F L Sbjct: 272 ILAGILIFGVLGYMAEEQMKPLTEVVSSGIGLAFVTIPTAINLMPAPYILGPLFFIALVI 331 Query: 351 AGLTSSIAIMQPMIAFLEDELKLSRKHAVLWTAAIVF-----FSAHLVMFLNKSLDEMDF 405 AGL+S I+I++ + + + D+ + RK A + ++ + F+ + + L LD +D+ Sbjct: 332 AGLSSHISIIEAVTSAVIDKFHVRRKPAAVLVCSLGYLVSMAFATNGGLLL---LDLVDY 388 Query: 406 WAGTIGVVFFGLTELIIFFWIFGADKAWEEINRGGIIKVPRIYYYVMRYITPAFLAVLL 464 + I ++ L EL+I W+ + N +V + +R+I+PA LA +L Sbjct: 389 FINNIALLLSCLLELVIITWLLKVTVIHQHANENSEFRVGGWFVVCLRFISPAILATIL 447 Lambda K H 0.330 0.146 0.463 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 703 Number of extensions: 43 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 513 Length of database: 503 Length adjustment: 34 Effective length of query: 479 Effective length of database: 469 Effective search space: 224651 Effective search space used: 224651 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory