Align acyl-CoA dehydrogenase subunit (EC 1.3.8.4; EC 1.3.8.5) (characterized)
to candidate 5209191 Shew_1669 butyryl-CoA dehydrogenase (RefSeq)
Query= metacyc::MONOMER-11693 (386 letters) >FitnessBrowser__PV4:5209191 Length = 385 Score = 237 bits (604), Expect = 5e-67 Identities = 140/383 (36%), Positives = 216/383 (56%), Gaps = 8/383 (2%) Query: 1 MDHRLTPELEELRRTVEEFAHDVVAPKIGDFYERHEFPYEIVREMGRMGLFGLPFPEEYG 60 MD L + + +FA + +AP + E H FP +++++ G +G L PE G Sbjct: 1 MDFNLNEDQRQFAELATQFAQEELAPFAAKWDEEHHFPKDVIQKAGELGFCSLYSPESEG 60 Query: 61 GMGGDYLALGIALEELARVDSSVAITLEAGVSLGAMPIHLFGTDAQKAEWLPRLCSGEIL 120 GMG L I E+LA ++ L ++ + FG+ + EW L +G L Sbjct: 61 GMGLSRLDSSIIFEQLAMGCTATTAMLTIH-NMATWMVTSFGSQTLRDEWSEALTTGNKL 119 Query: 121 GAFGLTEPDGGSDAGATRTTARLDESTNEWVINGTKCFITNSGTDITGLVTVTAVTGRKP 180 ++ LTE GSDA + +T A + +E+VI+G K FI+ +G+ T L+ V TG Sbjct: 120 ASYCLTEAGAGSDAASLKTKAVREG--DEYVISGAKMFISGAGS--TELLVVMCRTGDA- 174 Query: 181 DGKPLISSIIVPSGTPGFTVAAPYSKVGWNASDTRELSFADVRVPAANLLGEQGRGYAQF 240 G IS+I +P+ G + K+GWNA TRE++F VRVP NLLGE+G+G+ Sbjct: 175 -GPKGISAIAIPADAAGISYGKAEDKMGWNAQPTREITFDKVRVPVTNLLGEEGQGFTFA 233 Query: 241 LRILDEGRIAISALATGLAQGCVDESVKYAGERHAFGRNIGAYQAIQFKIADMEMKAHMA 300 ++ LD GRI I+ + G AQ ++ + +Y ER FG+ I A+QA+QFK+ADM + A Sbjct: 234 MKGLDGGRINIATCSVGTAQAALERAQQYMNERQQFGKPIAAFQALQFKLADMATELVAA 293 Query: 301 RVGWRDAASRLVAGEP-FKKEAAIAKLYSSTVAVDNAREATQIHGGYGFMNEYPVARMWR 359 R R AA +L +G+P A+AK +++ V + A Q+HGGYG++ EYP+ R +R Sbjct: 294 RQMVRLAAFKLDSGDPEATAYCAMAKRFATDVGFNVCDSALQLHGGYGYIREYPLERHFR 353 Query: 360 DSKILEIGEGTSEVQRMLIAREL 382 D ++ +I EGT+E+ R++IAR L Sbjct: 354 DVRVHQILEGTNEIMRLIIARRL 376 Lambda K H 0.318 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 389 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 385 Length adjustment: 30 Effective length of query: 356 Effective length of database: 355 Effective search space: 126380 Effective search space used: 126380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory