GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Shewanella loihica PV-4

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate 5210129 Shew_2573 carbamoyl-phosphate synthase L chain, ATP-binding (RefSeq)

Query= reanno::SB2B:6937189
         (673 letters)



>lcl|FitnessBrowser__PV4:5210129 Shew_2573 carbamoyl-phosphate
           synthase L chain, ATP-binding (RefSeq)
          Length = 677

 Score =  955 bits (2468), Expect = 0.0
 Identities = 485/677 (71%), Positives = 558/677 (82%), Gaps = 12/677 (1%)

Query: 1   MFNKLLIANRGEIACRVIRTARDMGIKTVAVYSDADRDARHVALADESFYLGESAPASSY 60
           MF KLLIANRGEIACR+I+TA+ MGIKTVA+YSDAD+DARHVA+ADESFYLG SAP+ SY
Sbjct: 1   MFTKLLIANRGEIACRIIKTAQVMGIKTVALYSDADKDARHVAMADESFYLGGSAPSESY 60

Query: 61  LRGELIIDIAKKCGAEAIHPGYGFLSENAAFARACEASGIAFVGPGSDAIDAMGSKSAAK 120
           L+GELI++IAK+ GA+AIHPGYGFLSENA FAR CE +GIAFVGP +DAIDAMGSKSAAK
Sbjct: 61  LKGELILEIAKRSGAQAIHPGYGFLSENADFARQCEQAGIAFVGPSADAIDAMGSKSAAK 120

Query: 121 LIMEKAGVPLVPGYHGDDQSDATLLAEAKKIGYPLLIKAAYGGGGKGMRIVESESELKAA 180
           +IME+A VPLVPGYHGDDQSD  LL  +K+IG+P LIKAAYGGGGKGMRIVESESE   A
Sbjct: 121 IIMEQANVPLVPGYHGDDQSDEVLLKASKEIGFPQLIKAAYGGGGKGMRIVESESEALEA 180

Query: 181 IDSARREAASSFGNDKLLMERYLRQPRHVEVQVFADSQGNCVYLSDRDCSIQRRHQKVVE 240
           I+SARREAASSFGNDKLL+ERYLRQPRHVEVQVFAD+QGNC+YLSDRDCSIQRRHQKVVE
Sbjct: 181 INSARREAASSFGNDKLLIERYLRQPRHVEVQVFADTQGNCIYLSDRDCSIQRRHQKVVE 240

Query: 241 EAPAPGLPDSLRKQMGEAAVAAAKAIDYRGAGTVEFLLDV-----DMSFFFMEMNTRLQV 295
           EAPAPGL DSLR+ MGEAAVAAAKAIDY GAGTVEFLLD        SF+FMEMNTRLQV
Sbjct: 241 EAPAPGLSDSLRRAMGEAAVAAAKAIDYVGAGTVEFLLDTHATEESNSFYFMEMNTRLQV 300

Query: 296 EHPVTEMVTGQDLVKWQLLVAAGAQLPLEQHEIQIHGHAFEVRIYAEDPNNEFLPASGKL 355
           EHPVTEMVTGQDLVKWQL+VA+G++LPL Q +++IHGH+FEVRIYAEDP NEFLPASGKL
Sbjct: 301 EHPVTEMVTGQDLVKWQLMVASGSELPLSQEDVRIHGHSFEVRIYAEDPQNEFLPASGKL 360

Query: 356 TFLREPEPSRHVRIDSGVRENDVISNYYDPMIAKLIVWDESRPRALARLTRALGDYRVGG 415
            FLREPE +R+VRIDSG+RENDVISN+YDPMIAKLIVWDESRPRAL RL  AL  Y++ G
Sbjct: 361 NFLREPEQNRYVRIDSGIRENDVISNFYDPMIAKLIVWDESRPRALQRLVHALESYQISG 420

Query: 416 LKHNIEFLSNIAEHPAFAQANFSTDFIGRYGDALI-----GDSRDEADTAFVLAVLTQLR 470
           LKHNIEFL+NIAEH AF+QA+FSTDFI RYGD LI     GD+  E + A   A L  L 
Sbjct: 421 LKHNIEFLANIAEHKAFSQADFSTDFIERYGDTLIGANLDGDNSHEQNGALAFAALYHLC 480

Query: 471 LREAVSQDVA--GHDPFSPWSSLKGFRLSSPRRHSVTLLDDAHQSRSAELTESNGRYQLC 528
            ++  ++  A    DP+SPW  + GFRL+    H ++LLDD H+ +   L++    Y L 
Sbjct: 481 AQKEQAKLTATNSQDPYSPWGQVSGFRLNRSGMHQLSLLDDEHEVQHLTLSQIGDCYYLN 540

Query: 529 LNDKLIELSGSIEDSELKCEINGHKMKVTVSLEDGGLTVFLSSGSYHFREVLGQVLEETA 588
           LND+ + LSG ++   L  EINGHK K+ VS E    T+FL SGSYHFR +  +V+EE A
Sbjct: 541 LNDQQLTLSGELKQDLLHAEINGHKSKIPVSREGDDFTLFLPSGSYHFRALQTEVVEEQA 600

Query: 589 SSEDKLKAPMNGTVVTHLVAAGDKVSAGQGLLVMEAMKMEYTIEAPFDGVVSEFFFAPGE 648
           +SEDKLKAPMNGT+VTHLV  GD+V AGQGL+VMEAMKMEYTIEAPFDG V+ FFF PGE
Sbjct: 601 NSEDKLKAPMNGTIVTHLVEVGDEVEAGQGLMVMEAMKMEYTIEAPFDGTVAAFFFQPGE 660

Query: 649 LVSDGTLLLALEMADAA 665
           LVSDG LLL +   + A
Sbjct: 661 LVSDGALLLEVTAKEDA 677


Lambda     K      H
   0.317    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1287
Number of extensions: 41
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 673
Length of database: 677
Length adjustment: 39
Effective length of query: 634
Effective length of database: 638
Effective search space:   404492
Effective search space used:   404492
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory