Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate 5209192 Shew_1670 enoyl-CoA hydratase (RefSeq)
Query= BRENDA::Q1D5Y4 (258 letters) >FitnessBrowser__PV4:5209192 Length = 257 Score = 161 bits (408), Expect = 1e-44 Identities = 96/248 (38%), Positives = 133/248 (53%), Gaps = 11/248 (4%) Query: 11 PIEIWTIDGESRRNAISRAMLKELGELVTRVSSSRDVRAVVITGAGDKAFCAGADLKERA 70 P WT D S A+LK+ VT +++++++ A+V+TG G+K F AGADLK A Sbjct: 21 PANTWTAD--------SLALLKQK---VTELNANKEIYALVLTGEGEKFFSAGADLKLFA 69 Query: 71 TMAEDEVRAFLDGLRRTFRAIEKSDCVFIAAINGAALGGGTELALACDLRVAAPAAELGL 130 + F A+ V IAAING A+GGG E+ALACD+R+A A + L Sbjct: 70 DGDKGNAATMAKHFGEAFEALSGFRGVSIAAINGYAMGGGLEVALACDIRIAEAQAVMAL 129 Query: 131 TEVKLGIIPGGGGTQRLARLVGPGRAKDLILTARRINAAEAFSVGLANRLAPEGHLLAVA 190 E +G++P GGTQ L +VG G AK +IL R+ A +A S+GL + +G L A Sbjct: 130 PEATVGLLPCAGGTQNLTAMVGEGWAKRMILCGERVGADKALSIGLIEEVVDKGAALDTA 189 Query: 191 YGLAESVVENAPIAVATAKHAIDEGTGLELDDALALELRKYEEILKTEDRLEGLRAFAEK 250 LAE V +P +V K I G + AL LE + + TED+ EG+ AF EK Sbjct: 190 MALAEKVANQSPSSVTVCKQLIQSGRAMPRTQALPLERELFVGLFDTEDQAEGVNAFLEK 249 Query: 251 RAPVYKGR 258 R +K R Sbjct: 250 RKANWKNR 257 Lambda K H 0.319 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory