Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate 5210215 Shew_2658 ABC transporter-related protein (RefSeq)
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__PV4:5210215 Length = 227 Score = 142 bits (358), Expect = 6e-39 Identities = 81/224 (36%), Positives = 133/224 (59%), Gaps = 10/224 (4%) Query: 21 IRIEGLNKHYGA-----FHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQG 75 I I+ L K Y ++ +DL + +GE + + GPSGSGK+TL+ I ++ G Sbjct: 3 IAIQALTKIYNPESDFPVAAVKSLDLTIAQGEFVAIMGPSGSGKTTLLNMIGGIDSPSSG 62 Query: 76 SIQVDGIDLAATTREA--AQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAE 133 ++ +DG D+ + +A A R +G +FQ ++L P ++ L+N ++G S + Sbjct: 63 AVFIDGEDITHLSEQALIAFRRDHVGFIFQDYSLLPVLTALENVEFV-MQLQGHSEAECR 121 Query: 134 ERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAE 193 +RA L++VG+ +Q K P++LSGGQQQRVA+ARAL +PR ++ DEPT+ LD + AE Sbjct: 122 DRAMALLAQVGLAAQQDKIPAKLSGGQQQRVAVARALAPRPRFVMADEPTANLDAKSTAE 181 Query: 194 VLDVLVQL-AGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIED 236 +LD++ L G T + TH+ + A+RV+ E G+++ED Sbjct: 182 LLDIMQSLNEQEGTTFIFSTHDPRVIAR-AKRVIVFEDGRLVED 224 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 148 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 227 Length adjustment: 23 Effective length of query: 237 Effective length of database: 204 Effective search space: 48348 Effective search space used: 48348 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory