Align Inositol transport system ATP-binding protein (characterized)
to candidate 5210162 Shew_2606 ABC transporter-related protein (RefSeq)
Query= reanno::Phaeo:GFF717 (261 letters) >FitnessBrowser__PV4:5210162 Length = 272 Score = 97.8 bits (242), Expect = 2e-25 Identities = 74/250 (29%), Positives = 123/250 (49%), Gaps = 18/250 (7%) Query: 6 PLIRMQGIEKHFGSVI-ALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKP----- 59 PL+ + IE + VI L GVS++V GE LLG NGAGKST +K +SG+ K Sbjct: 12 PLLAINNIEVVYDDVIQVLRGVSIEVPQGEIVTLLGPNGAGKSTTLKAISGLLKTENGEV 71 Query: 60 TKGDILFEGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLF 119 ++GDI F G+ + + D + +G+ V + ++ M+V N +G R Sbjct: 72 SRGDIHFMGERIDVKNADDVVRSGLFQVMEGRRIVEDMTVIENLKLGAYTRR-------- 123 Query: 120 DHDYANRITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSAL 179 D +E + L+ G LSGGE+Q +AI RA+ K++ LDEP+ L Sbjct: 124 --DGQVNQDIEMVFNYFPRLKERTGLAGYLSGGEQQMLAIGRALMARPKMICLDEPSMGL 181 Query: 180 GVRQTANVLATIDKV-RKQGVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGD-ISA 237 V I+K+ R+QG+ ++ + N +AL + ++ GK + + ++ Sbjct: 182 SPLLVKEVFGIIEKINREQGITMLLVEQNANYALKAANYGYIMESGKIVLDGTKAQLLNN 241 Query: 238 EELQDMMAGG 247 E++++ GG Sbjct: 242 EDVKEFYLGG 251 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 272 Length adjustment: 25 Effective length of query: 236 Effective length of database: 247 Effective search space: 58292 Effective search space used: 58292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory