Align BadI (characterized)
to candidate 5208024 Shew_0540 enoyl-CoA hydratase/isomerase (RefSeq)
Query= metacyc::MONOMER-892 (260 letters) >FitnessBrowser__PV4:5208024 Length = 245 Score = 88.2 bits (217), Expect = 1e-22 Identities = 67/223 (30%), Positives = 100/223 (44%), Gaps = 20/223 (8%) Query: 1 MQFEDLIYEIRNGVAWIIINRPDKMNAFRGTTCDELIKALYKAGYDKDVGAIVLAGAGDR 60 +QF+D GV I INRPDK NA L + L + D + A +L G GD Sbjct: 4 IQFQD-----EQGVRIITINRPDKRNALNLEMYARLTEYLIQGESDNGINAFLLKGEGD- 57 Query: 61 AFCTGGDQSTHDGNYDGRGTVGLPMEELHTAIR------DVPKPVIARVQGYAIGGGNVL 114 F +G D + N D + + H +R D+ KP++A V G A+G G L Sbjct: 58 CFTSGNDVADFLKNSD--------LGQNHPTVRFLFTLLDLTKPLVAAVAGPAVGIGTTL 109 Query: 115 ATICDLTICSEKAIFGQVGPKMGSVDPGYGTAFLARVVGEKKAREIWYMCKRYSGKEAEA 174 CDL A F + V + L R+VG+ KA E+ + + + + A + Sbjct: 110 LLHCDLVYADNTAKFQLPFVNLALVPEAGASLLLPRLVGQTKASELLLLGEPFDAQSALS 169 Query: 175 MGLANLCVPHDELDAEVQKWGEELCERSPTALAIAKRSFNMDT 217 MGL N +P DEL + +L ++ P AL ++R D+ Sbjct: 170 MGLINDLLPSDELMSHAMSQSIKLAKKPPQALRASRRLIRGDS 212 Lambda K H 0.319 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 3 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 245 Length adjustment: 24 Effective length of query: 236 Effective length of database: 221 Effective search space: 52156 Effective search space used: 52156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory