Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate 5209711 Shew_2164 acyl-CoA dehydrogenase domain-containing protein (RefSeq)
Query= metacyc::G1G01-166-MONOMER (393 letters) >FitnessBrowser__PV4:5209711 Length = 596 Score = 97.4 bits (241), Expect = 9e-25 Identities = 102/376 (27%), Positives = 171/376 (45%), Gaps = 51/376 (13%) Query: 56 FREMGEVGLLGATIPEQYGGSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEF 115 +++ + G T +YGG GL C G+ A E++ + +M + I+ Sbjct: 82 YQQYVDNGWATLTSDPEYGGQGLPE-CIGVFATEMKTATNMAFAMYPGLTHGAYAAIHAH 140 Query: 116 GTEAQKQKYLPKLASGEWIGCFGLTEPNHGSDPGSMITRARKV-DGGYRLTGSKMWITNS 174 G++A K KYL KL SGEW G LTE + G+D + T+A+ V + Y ++G K++I++ Sbjct: 141 GSDALKAKYLEKLVSGEWTGTMNLTEAHAGTDLALLRTKAKPVGEDTYAISGEKIFISSG 200 Query: 175 --PIAD--VFVVWAK-DDAGD-IRGFVL---------EKGW----QGLSAPAIHGKVGLR 215 +AD V +V A+ DA D ++G L + G G+ A A+ K+G+ Sbjct: 201 DHDLADNIVHLVLARLPDAPDGVKGISLFAVPKYLVNDDGTLGCRNGVEASALEHKMGIH 260 Query: 216 ASITGEIVMDNVFVPEENIFPDVRGLKGPFTCLNSARYGISWGALGAAEACWHTARQYTL 275 + T +V D E + +GL+ FT +N AR G+ LG +E + A Y Sbjct: 261 GNSTCVMVFDGAI--GELVGEPHQGLRAMFTMMNEARLGVGVQGLGVSEIAYQNALSYAR 318 Query: 276 DRQQFGRPLA-----------------ANQLIQKKLADMQTEITLALQGCLRLG---RMK 315 +R Q GR L+ +++ + A Q L Q L L R + Sbjct: 319 ERLQ-GRALSGVKESESPADPILVHGDVRRMLMAQKAFNQGARALMGQQALWLDESHRHQ 377 Query: 316 DEGTAAVE------ITSIMKRNSCGKALDIARMARDMLGGNGISDEFGVARHLVNLEVVN 369 D+ A + T ++K + A+ + GG+G E+G+ + + + + Sbjct: 378 DKAKATIAAKLAALFTPVVKGFVTDQGFKACVDAQQVYGGHGYIHEWGMEQFVRDSRIAM 437 Query: 370 TYEGTHDVHAL-ILGR 384 YEGT+ V AL ++GR Sbjct: 438 IYEGTNGVQALDLVGR 453 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 393 Length of database: 596 Length adjustment: 34 Effective length of query: 359 Effective length of database: 562 Effective search space: 201758 Effective search space used: 201758 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory