Align phenylacetate-CoA ligase (EC 6.2.1.30) (characterized)
to candidate 5210656 Shew_3084 AMP-dependent synthetase and ligase (RefSeq)
Query= BRENDA::A7KUK6 (562 letters) >FitnessBrowser__PV4:5210656 Length = 531 Score = 197 bits (502), Expect = 7e-55 Identities = 149/487 (30%), Positives = 237/487 (48%), Gaps = 28/487 (5%) Query: 70 GDVLALFTPNSIDTPVVMWGTLWAGGTISPANPGYTVDELAFQLKNSHAKGLVTQASVLP 129 GD +A+ PN + +G L AG + NP YT EL Q ++S AK LV + +LP Sbjct: 66 GDKVAIQLPNITQFVIAAYGALRAGMILVNTNPLYTQRELIHQYRDSDAKALVVLSDLLP 125 Query: 130 ----VAREAAKKVGMPEDRIILIGDQRDPDARVKH--FTSVRNISGATRYRKQKITPAKD 183 V E + + + LI Q D+++ H F V + YR ++ + Sbjct: 126 TLETVIPETQIETVISTHPLDLIATQPQADSQLAHIGFNQVLALGSQAEYRPVEVAQ-QS 184 Query: 184 VAFLVYSSGTTGVPKGVMISHRNIVANIRQQFIAEGEMLSWNGGPDGKGDRV-LAFLPFY 242 +A L Y+ GTTG+ KG M+SH N++AN+ Q + S +G+ + +A LP Y Sbjct: 185 LAALQYTGGTTGLSKGAMLSHSNLLANMLQ-------VQSRLASKFVEGEEIFIAPLPIY 237 Query: 243 HIYGLTCLITQALYKGYHLIVMSKFDIEKWCAHVQNYRCSFSYIVPPVVLLLGKHPVVDK 302 HIY G +++ + DI + + + + + + L Sbjct: 238 HIYAFMVNFVYFEQGGCSVLIPNPRDISALIQTMSQHPFTGFAGLNTLFVGLCHQQSFQA 297 Query: 303 YDLSSLRMMNSGAAPLTQELVEAVYSRIKVGIKQGYGLSETSPTTHSQRWEDWREAMGSV 362 D S L++ SG LTQ S I +GYGLSETSP E +G++ Sbjct: 298 LDFSHLKITISGGTALTQAAASIWQSTTGCTISEGYGLSETSPVVSLNA--PGLECLGTI 355 Query: 363 GRLMPNMQAKYMTMPEDGSEPKEVGEGEVGELYLKGPNVFLGYHENPEATKGCLSEDGWF 422 GR + + Q K + D SE +EV +GE+GEL +KGP V GY + PE T ++ DG+F Sbjct: 356 GRPVIDTQVKIL----DASE-QEVPQGEIGELAVKGPQVMSGYWQKPEETAKVMTSDGFF 410 Query: 423 QTGDVGYQDAKGNFYITDRVKELIKYKGFQVPPAELEGYLVDNDAIDDVAVIGIESETHG 482 +TGD+ G I DR K++I GF V P E+E L ++++ + AVIG++ G Sbjct: 411 KTGDIALATEDGMHKIVDRKKDMIIVSGFNVYPNEVEDVLAAHESVLECAVIGVDDSRSG 470 Query: 483 SEVPMACVVRSAKSKSSGTSEKDEAARIIKWLDSKVASHKRLRGGVHFVDEIPKNPSGKI 542 V A V+R + + T + +++ +++A++K L + F+ +PK+ GKI Sbjct: 471 EAVKAAIVLREPELANDATKQ-----ALLEHCRAQLAAYK-LPKIIEFMPALPKSTVGKI 524 Query: 543 LRRILKQ 549 LRR L++ Sbjct: 525 LRRELRK 531 Lambda K H 0.317 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 631 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 562 Length of database: 531 Length adjustment: 36 Effective length of query: 526 Effective length of database: 495 Effective search space: 260370 Effective search space used: 260370 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory