Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate 5210126 Shew_2570 acyl-CoA dehydrogenase domain-containing protein (RefSeq)
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__PV4:5210126 Length = 389 Score = 100 bits (250), Expect = 5e-26 Identities = 69/217 (31%), Positives = 106/217 (48%), Gaps = 16/217 (7%) Query: 45 EWYRILNKKGWAVTHWPKEYGGTGWSSVQHYIFNEELQAAPAPQPLAFGV--SMVGPVIY 102 E + +L + G P+EYGG + H + EE+ A A L++G ++ I Sbjct: 47 ELWPVLGEMGLLGVTVPEEYGGADMGYLAHVVAMEEISRASASIGLSYGAHSNLCVNQIN 106 Query: 103 TFGSEEQKKRFLPRIANVDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTTL 162 G+ EQK ++LP++ + + SEP +GSD+ S+K A K+GD++I+NG K W T Sbjct: 107 RNGNAEQKAKYLPKLVSGEHIGALAMSEPNAGSDVVSMKLSARKEGDRYILNGNKMWITN 166 Query: 163 AQHADWIFCLCRTDPAAKKQEGISFILVDMKTKGITVRPIQTID----GGHEVNEVFFDD 218 AD +TD K GI+ +V+ KG + Q +D G E+ F+D Sbjct: 167 GPDADTYVIYAKTD-MDKGPHGITAFIVERGFKGFS--QAQKLDKLGMRGSNTCELVFED 223 Query: 219 VEVPLENLVGQEN-------KGWDYAKFLLGNERTGI 248 EVP EN++G N G DY + +L GI Sbjct: 224 CEVPEENILGGLNNGVKVLMSGLDYERVVLSGGPLGI 260 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 307 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 389 Length adjustment: 31 Effective length of query: 365 Effective length of database: 358 Effective search space: 130670 Effective search space used: 130670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory