Align Phenylalanine 4-monooxygenase (EC 1.14.16.1) (characterized)
to candidate 5208934 Shew_1435 phenylalanine 4-monooxygenase (RefSeq)
Query= reanno::MR1:200831 (271 letters) >FitnessBrowser__PV4:5208934 Length = 277 Score = 385 bits (990), Expect = e-112 Identities = 192/258 (74%), Positives = 208/258 (80%), Gaps = 1/258 (0%) Query: 11 YVARSADDSGYIHYPQEEHDIWRQLYARQAVNLPGRACKEYLQGLDALAMPKDRIPQLAE 70 Y AR D G I YP EH+IW+ LY RQ NLP AC YL+GL+ LA+P DRIPQL E Sbjct: 19 YQARLPDSQGVIQYPDNEHEIWQALYDRQKGNLPHYACDAYLKGLEDLALPADRIPQLGE 78 Query: 71 IDKVLMATTGWKTADVPALISFGRFFELLANKEFPVATFIRRKEEFDYLQEPDIFHEIFG 130 ID VL TGWKTA VPALISF +FF+LLAN+EFPVATFIR KEEFDYLQEPDIFHEIFG Sbjct: 79 IDAVLQQATGWKTAAVPALISFEKFFQLLANQEFPVATFIRSKEEFDYLQEPDIFHEIFG 138 Query: 131 HCPLLTNPSFAHFSHMYGQLGLNASKEDRVFLARLYWFTVEFGLLKPQEGELCIYGGGIL 190 HCPLLTNPSFA FSH YG+LGL ASKE+RVFLARLYWFTVEFGL++ EL IYGGGIL Sbjct: 139 HCPLLTNPSFARFSHEYGKLGLAASKEERVFLARLYWFTVEFGLIRQTNDELKIYGGGIL 198 Query: 191 SSPGETLYAMESQVPERKPFDLLDVLRTPYRIDIMQPIYYVIEHIDVLDEIAKMDIMAYV 250 SSPGETLYAM S P KPFDLLD+LRTPYRIDIMQPIYY I+ ID LDEI KMDIM V Sbjct: 199 SSPGETLYAM-SDTPVVKPFDLLDILRTPYRIDIMQPIYYAIDSIDYLDEIVKMDIMGAV 257 Query: 251 AKARQLGLFAPKYPPKAK 268 KARQLGL AP + PK+K Sbjct: 258 TKARQLGLHAPMFEPKSK 275 Lambda K H 0.323 0.140 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 303 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 277 Length adjustment: 25 Effective length of query: 246 Effective length of database: 252 Effective search space: 61992 Effective search space used: 61992 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 47 (22.7 bits)
Align candidate 5208934 Shew_1435 (phenylalanine 4-monooxygenase (RefSeq))
to HMM TIGR01267 (phhA: phenylalanine-4-hydroxylase (EC 1.14.16.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01267.hmm # target sequence database: /tmp/gapView.23856.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01267 [M=248] Accession: TIGR01267 Description: Phe4hydrox_mono: phenylalanine-4-hydroxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-103 329.9 0.0 4.9e-103 329.7 0.0 1.0 1 lcl|FitnessBrowser__PV4:5208934 Shew_1435 phenylalanine 4-monoox Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208934 Shew_1435 phenylalanine 4-monooxygenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 329.7 0.0 4.9e-103 4.9e-103 2 247 .. 23 268 .. 22 269 .. 0.98 Alignments for each domain: == domain 1 score: 329.7 bits; conditional E-value: 4.9e-103 TIGR01267 2 ftvaqdldryseeehavwatlidrqlkllegracdeyldGveklgldadripdleevneklraltGwkivavpglipa 79 +++q+ ++y+++eh++w++l+drq l+ acd yl+G+e l l+adrip+l e++ +l+++tGwk +avp+li + lcl|FitnessBrowser__PV4:5208934 23 LPDSQGVIQYPDNEHEIWQALYDRQKGNLPHYACDAYLKGLEDLALPADRIPQLGEIDAVLQQATGWKTAAVPALISF 100 57899************************************************************************* PP TIGR01267 80 dvffehlanrrfpvttflrtpeeldylqepdvfhdlfGhvpllsnpvfadfleayGkkgvkakalgaallarlywytv 157 + ff++lan++fpv+tf+r +ee+dylqepd+fh++fGh+pll+np fa f + yGk+g+ a+++++++larlyw+tv lcl|FitnessBrowser__PV4:5208934 101 EKFFQLLANQEFPVATFIRSKEEFDYLQEPDIFHEIFGHCPLLTNPSFARFSHEYGKLGLAASKEERVFLARLYWFTV 178 ****************************************************************************** PP TIGR01267 158 efGlvetaag.lriyGaGilsskkelvyaleskeplrvafdllevmrtryridklqkayfvlpslkrlfdaaqedfea 234 efGl++++++ l+iyG+Gilss+ e++ya s+ p ++fdll+++rt+yrid++q++y+ ++s++ l ++++ d++ lcl|FitnessBrowser__PV4:5208934 179 EFGLIRQTNDeLKIYGGGILSSPGETLYA-MSDTPVVKPFDLLDILRTPYRIDIMQPIYYAIDSIDYLDEIVKMDIMG 255 *****766555******************.89********************************************** PP TIGR01267 235 lvaeakdlkaldp 247 v++a++l++++p lcl|FitnessBrowser__PV4:5208934 256 AVTKARQLGLHAP 268 ********99998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (248 nodes) Target sequences: 1 (277 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 7.41 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory