Align dihydromonapterin reductase (EC 1.5.1.50) (characterized)
to candidate 5207514 Shew_0048 short chain dehydrogenase (RefSeq)
Query= BRENDA::P0AFS3 (240 letters) >FitnessBrowser__PV4:5207514 Length = 235 Score = 231 bits (588), Expect = 1e-65 Identities = 123/232 (53%), Positives = 157/232 (67%), Gaps = 1/232 (0%) Query: 9 ILITGGGRRIGLALAWHFINQKQPVIVSYRTHYPAIDGLINAGAQCIQADFSTNDGVMAF 68 ILITG G+RIGL LA F+ + VI +YR+HYP+ID L GA DF+ + Sbjct: 5 ILITGVGKRIGLYLAEAFLTRGYKVIGTYRSHYPSIDALTKLGADLYPCDFTVQSQLEEL 64 Query: 69 ADEVLKSTHGLRAILHNASAWMAEKPGAPLADVLACMMQIHVNTPYLLNHALERLLRGHG 128 + ++ L A++HNAS W+ + A V+A MMQ+HV PY LN AL LL+ Sbjct: 65 IQTLKQNYRQLDAVIHNASLWLDDNDPAGADQVIAQMMQVHVYAPYQLNLALTPLLQNQ- 123 Query: 129 HAASDIIHFTDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNSIAPSLILFNE 188 A +DIIH TDYV ++GS KHIAYAASKAAL+NMT SFA KLAP+VKVN+IAP+LI FNE Sbjct: 124 QAMTDIIHITDYVAQKGSKKHIAYAASKAALENMTLSFAAKLAPKVKVNAIAPALICFNE 183 Query: 189 HDDAEYRQQALNKSLMKTAPGEKEVIDLVDYLLTSCFVTGRSFPLDGGRHLR 240 HDDA YR++A KS++ GE EV+ +DYL+ S +VTGRS LDGGR L+ Sbjct: 184 HDDAAYREKARAKSVLAREGGEVEVLQAIDYLMQSQYVTGRSLALDGGRQLK 235 Lambda K H 0.322 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 166 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 235 Length adjustment: 23 Effective length of query: 217 Effective length of database: 212 Effective search space: 46004 Effective search space used: 46004 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory