Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 5210162 Shew_2606 ABC transporter-related protein (RefSeq)
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__PV4:5210162 Length = 272 Score = 218 bits (554), Expect = 1e-61 Identities = 120/245 (48%), Positives = 169/245 (68%), Gaps = 9/245 (3%) Query: 4 KSNKVLLQVKGLKVAYGG-IQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTLSMN 62 K LL + ++V Y IQ ++GV EV +GE+V+L+G NGAGK+TT+KAI+G L Sbjct: 8 KPETPLLAINNIEVVYDDVIQVLRGVSIEVPQGEIVTLLGPNGAGKSTTLKAISGLLKTE 67 Query: 63 DG-----NIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITENLQMGAYIRKDKAG 117 +G +I ++G+ I K A D+V+ GL V EGR + MT+ ENL++GAY R+D Sbjct: 68 NGEVSRGDIHFMGERIDVKNADDVVRSGLFQVMEGRRIVEDMTVIENLKLGAYTRRD-GQ 126 Query: 118 ILADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIM 177 + DIE +F FPRL+ER LAG +SGGEQQMLA+GRALM++PK++ LDEPSMGLSP++ Sbjct: 127 VNQDIEMVFNYFPRLKERTG-LAGYLSGGEQQMLAIGRALMARPKMICLDEPSMGLSPLL 185 Query: 178 VDKIFEVVRDV-YALGVTIVLVEQNASRALAIADRGYVMESGLITMTGPGQQLLNDPKVR 236 V ++F ++ + G+T++LVEQNA+ AL A+ GY+MESG I + G QLLN+ V+ Sbjct: 186 VKEVFGIIEKINREQGITMLLVEQNANYALKAANYGYIMESGKIVLDGTKAQLLNNEDVK 245 Query: 237 AAYLG 241 YLG Sbjct: 246 EFYLG 250 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 272 Length adjustment: 24 Effective length of query: 218 Effective length of database: 248 Effective search space: 54064 Effective search space used: 54064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory