Align Phenylacetyl-CoA:acceptor oxidoreductase small subunit PadC (characterized, see rationale)
to candidate 5207723 Shew_0244 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein (RefSeq)
Query= uniprot:A0A2R4BLY8 (215 letters) >FitnessBrowser__PV4:5207723 Length = 231 Score = 142 bits (357), Expect = 7e-39 Identities = 79/210 (37%), Positives = 103/210 (49%), Gaps = 33/210 (15%) Query: 3 RYAMVADLRRCVGCQTCTAACKHTNATPPGVQWRWVLDVEAGEFPDVSRTFVPVGCQHCD 62 RYAMV D+RRC GC +CT +C N T G V ++ VP C CD Sbjct: 33 RYAMVFDVRRCTGCLSCTVSCSVENQTDAGRCRTRVNQASLSLGERIATLAVPNQCNQCD 92 Query: 63 EPPCETVCPTTAT-KKRADGLVTIDYDLCIGCAYCSVACPYNARYKVNFAEPAYGDRLMA 121 P C VCP AT K++ DG+V ID++ CI C C ACPY AR K D + Sbjct: 93 NPVCTQVCPVEATYKRKEDGIVVIDHEECIHCQLCVDACPYGARRK---------DESLD 143 Query: 122 NEKQRADPARVGVATKCTFCSDRIDYGVAHGLTPGVDPDATPACANACIANALTFGDIDD 181 N + KC FC R+ G+ PAC CI A TFGD++D Sbjct: 144 NPPE-----------KCNFCIHRVTQGLL------------PACVETCIGGARTFGDLND 180 Query: 182 PNSKASRLLRENEHFRMHEELGTGPGFFYL 211 P+S+ S+L+R+N+ + M E GT P FY+ Sbjct: 181 PDSQVSKLVRDNKVYAMLSEAGTSPNIFYI 210 Lambda K H 0.323 0.137 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 20 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 231 Length adjustment: 22 Effective length of query: 193 Effective length of database: 209 Effective search space: 40337 Effective search space used: 40337 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory