Align ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale)
to candidate 5210162 Shew_2606 ABC transporter-related protein (RefSeq)
Query= uniprot:D8IUY7 (241 letters) >FitnessBrowser__PV4:5210162 Length = 272 Score = 220 bits (561), Expect = 2e-62 Identities = 122/244 (50%), Positives = 169/244 (69%), Gaps = 7/244 (2%) Query: 3 TNILKVQQLSVAYGG-IQAVKGIDLEVNEGELVTLIGANGAGKTTTLKAITGTLPASRVE 61 T +L + + V Y IQ ++G+ +EV +GE+VTL+G NGAGK+TTLKAI+G L E Sbjct: 11 TPLLAINNIEVVYDDVIQVLRGVSIEVPQGEIVTLLGPNGAGKSTTLKAISGLLKTENGE 70 Query: 62 ---GHIEYLGQPLKGKKSFELVKDKLAMVPEGRGVFTRMSIQENLLMGAYTSDDKGQIAA 118 G I ++G+ + K + ++V+ L V EGR + M++ ENL +GAYT D GQ+ Sbjct: 71 VSRGDIHFMGERIDVKNADDVVRSGLFQVMEGRRIVEDMTVIENLKLGAYTRRD-GQVNQ 129 Query: 119 DIDKWFAVFPRLKERAAQMAGTLSGGEQQMLAMARALMSHPKLLLLDEPSMGLSPIMVEK 178 DI+ F FPRLKER +AG LSGGEQQMLA+ RALM+ PK++ LDEPSMGLSP++V++ Sbjct: 130 DIEMVFNYFPRLKERTG-LAGYLSGGEQQMLAIGRALMARPKMICLDEPSMGLSPLLVKE 188 Query: 179 IFEVIRNVS-AQGITILLVEQNAKLALEAAHRGYVMESGLITMQGQAQQMLDDPRVKAAY 237 +F +I ++ QGIT+LLVEQNA AL+AA+ GY+MESG I + G Q+L++ VK Y Sbjct: 189 VFGIIEKINREQGITMLLVEQNANYALKAANYGYIMESGKIVLDGTKAQLLNNEDVKEFY 248 Query: 238 LGEG 241 LG G Sbjct: 249 LGGG 252 Lambda K H 0.317 0.134 0.365 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 206 Number of extensions: 9 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 241 Length of database: 272 Length adjustment: 24 Effective length of query: 217 Effective length of database: 248 Effective search space: 53816 Effective search space used: 53816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory