Align Glutarate-semialdehyde dehydrogenase; EC 1.2.1.- (characterized)
to candidate 5208455 Shew_0967 aldehyde dehydrogenase (RefSeq)
Query= SwissProt::Q9I6M5 (483 letters) >FitnessBrowser__PV4:5208455 Length = 498 Score = 285 bits (730), Expect = 2e-81 Identities = 170/482 (35%), Positives = 267/482 (55%), Gaps = 8/482 (1%) Query: 2 QLKDAKLFRQQAYVDGAWVDADNGQTIKVNNPATGEIIGSVPKMGAAETRRAIEAADKAL 61 ++ D+ + + QA+++G + AD+ T +P G ++ V + RA+ A + Sbjct: 12 EMADSLVIQGQAFINGEYCAADSNDTFDCISPIDGRVLTQVASCDLLDANRAVANAREVF 71 Query: 62 PA--WRALTAKERANKLRRWFDLMIENQDDLARLMTIEQGKPLAEAKG-EIAYAASFLEW 118 W L +R + R+ DL+ N+D+LA L T++ GKP+ + ++A AA L W Sbjct: 72 ERGDWSQLPPVKRKQVMIRFADLLEANRDELALLETLDMGKPIRYSGAVDVAGAARALRW 131 Query: 119 FGEEAKRIYGDTIPGHQPDKRIIVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMV 178 GE +IY + P + +I ++P+GV AAI PWNFP M K GPALA G ++V Sbjct: 132 SGEAVDKIYDEIAPTAHNEIGMIT-REPVGVVAAIVPWNFPLLMACWKLGPALATGNSVV 190 Query: 179 LKPASQTPYSALALAELAERAGIPKGVFSVVTGSAGEVGGELTSNPIVRKLTFTGSTEIG 238 LKP+ ++P +A+ +A+LA AGIPKGV +V+ G VG L + V L FTGST+I Sbjct: 191 LKPSEKSPLTAIRMAQLAIEAGIPKGVLNVLPGYGHTVGKALALHMDVDTLVFTGSTKIA 250 Query: 239 RQLMAECAQ-DIKKVSLELGGNAPFIVFDDA-DLDAAVEGALISKYRNNGQTCVCANRLY 296 +QLM + ++K+V LE GG +P IVF+DA +L A A + N G+ C +RL Sbjct: 251 KQLMIYAGESNMKRVWLEAGGKSPNIVFNDAPNLKEAAIAAASAIAFNQGEVCTAGSRLL 310 Query: 297 VQDGVYDAFVDKLKAAVAKLNIGNGLEAGVTTGPLIDAKAVAKVEEHIADAVSKGAKVVS 356 V+ GV + ++ ++A + G+ L+ T G ++D + + V +I V++GA++ Sbjct: 311 VESGVKEELINLIEAEMQAWQPGHPLDPATTCGAVVDQQQLENVLRYIRAGVAEGAQLRQ 370 Query: 357 GGKP--HALGGTFFEPTILVDVPKNALVSKDETFGPLAPVFRFKDEAEVIAMSNDTEFGL 414 GG+ GG + PTI +V ++K+E FGP+ V F E I + NDT +GL Sbjct: 371 GGQQVLAETGGVYVAPTIFANVKNEMTIAKEEIFGPVLSVITFDGMEEAIRIGNDTIYGL 430 Query: 415 ASYFYARDLARVFRVAEQLEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLE 474 A+ + D+++ + A+ L GMV IN + APFGG K SG GR+ S + + Y E Sbjct: 431 AAGVWTSDISKAHKTAKALRSGMVWINHYDGGDMTAPFGGYKQSGNGRDKSLHAFDKYTE 490 Query: 475 IK 476 IK Sbjct: 491 IK 492 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 582 Number of extensions: 36 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 498 Length adjustment: 34 Effective length of query: 449 Effective length of database: 464 Effective search space: 208336 Effective search space used: 208336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory