Align glutaryl-CoA dehydrogenase (ETF) (EC 1.3.8.6) (characterized)
to candidate 5210126 Shew_2570 acyl-CoA dehydrogenase domain-containing protein (RefSeq)
Query= BRENDA::Q3JP94 (395 letters) >FitnessBrowser__PV4:5210126 Length = 389 Score = 221 bits (562), Expect = 4e-62 Identities = 133/371 (35%), Positives = 202/371 (54%), Gaps = 2/371 (0%) Query: 18 LADDERMVRDAAHAYAQGKLAPRVTEAFRHETTDAAIFREMGEIGLLGPTIPEQYGGPGL 77 L +D M+RDA ++A ++AP + + ++ +GE+GLLG T+PE+YGG + Sbjct: 12 LGEDIDMLRDAVRSFAANEIAPIAAKVDQENAFPNELWPVLGEMGLLGVTVPEEYGGADM 71 Query: 78 DYVSYGLIAREVERVDSGYRSMMSVQSSLVMVPIFEFGSDAQKEKYLPKLATGEWIGCFG 137 Y+++ + E+ R + S+L + I G+ QK KYLPKL +GE IG Sbjct: 72 GYLAHVVAMEEISRASASIGLSYGAHSNLCVNQINRNGNAEQKAKYLPKLVSGEHIGALA 131 Query: 138 LTEPNHGSDPGSMVTRARKVPGGYSLSGSKMWITNSPIADVFVVWAKLDED-GRDEIRGF 196 ++EPN GSD SM ARK Y L+G+KMWITN P AD +V++AK D D G I F Sbjct: 132 MSEPNAGSDVVSMKLSARKEGDRYILNGNKMWITNGPDADTYVIYAKTDMDKGPHGITAF 191 Query: 197 ILEKGCKGLSAPAIHGKVGLRASITGEIVLDEAFVPEENILPHV-KGLRGPFTCLNSARY 255 I+E+G KG S K+G+R S T E+V ++ VPEENIL + G++ + L+ R Sbjct: 192 IVERGFKGFSQAQKLDKLGMRGSNTCELVFEDCEVPEENILGGLNNGVKVLMSGLDYERV 251 Query: 256 GIAWGALGAAESCWHIARQYVLDRKQFGRPLAANQLIQKKLADMQTEITLGLQGVLRLGR 315 ++ G LG +C I Y+ +R+QFG+ + QL+Q KLADM T + V + + Sbjct: 252 VLSGGPLGIMTACMDIVVPYIHEREQFGKSIGQFQLVQGKLADMYTGMNAAKSYVYNVAK 311 Query: 316 MKDEGTAAVEITSIMKRNSCGKALDIARLARDMLGGNGISDEFGVARHLVNLEVVNTYEG 375 D G + + S A +A A +LGGNG +E+ R L + ++ G Sbjct: 312 SCDRGETTRKDAAGAILYSAELATKMALDAIQLLGGNGYVNEYATGRLLRDAKLYEIGAG 371 Query: 376 THDIHALILGR 386 T +I +++GR Sbjct: 372 TSEIRRMLIGR 382 Lambda K H 0.320 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 372 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 389 Length adjustment: 31 Effective length of query: 364 Effective length of database: 358 Effective search space: 130312 Effective search space used: 130312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory