GapMind for catabolism of small carbon sources

 

Aligments for a candidate for proV in Shewanella loihica PV-4

Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)

Query= CharProtDB::CH_001555
         (400 letters)



>lcl|FitnessBrowser__PV4:5208351 Shew_0863 ABC transporter-related
           protein (RefSeq)
          Length = 342

 Score =  144 bits (363), Expect = 4e-39
 Identities = 81/238 (34%), Positives = 138/238 (57%), Gaps = 5/238 (2%)

Query: 44  VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103
           ++   L + +GEI  ++G SG GK+T+++ +  L   ++G++ I+G  ++        E 
Sbjct: 19  LRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRISINGRLLSGPETFVPSE- 77

Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPD 163
            R+++ M+FQ +AL PH+TV +N  FG++  G++   R+ +  + L  V LE     YP 
Sbjct: 78  -RREVGMIFQDYALFPHLTVAENILFGVK--GLDKAARQARLGEMLALVKLEGLGGRYPH 134

Query: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223
           ELSGG +QRV +ARALA  P++LL+DE FS +D  +R EM  E+ ++  +   + VF++H
Sbjct: 135 ELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEIREILKQRGVSAVFVTH 194

Query: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR 281
             DEA    D++A+ ++G + Q G+ + +   P + YV  F   V+       KD AR
Sbjct: 195 SKDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLGQVNYLSC-EVKDRAR 251


Lambda     K      H
   0.319    0.137    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 335
Number of extensions: 23
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 400
Length of database: 342
Length adjustment: 30
Effective length of query: 370
Effective length of database: 312
Effective search space:   115440
Effective search space used:   115440
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory