Align glycine betaine/l-proline transport atp-binding protein prov (characterized)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= CharProtDB::CH_001555 (400 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 144 bits (363), Expect = 4e-39 Identities = 81/238 (34%), Positives = 138/238 (57%), Gaps = 5/238 (2%) Query: 44 VKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREV 103 ++ L + +GEI ++G SG GK+T+++ + L ++G++ I+G ++ E Sbjct: 19 LRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRISINGRLLSGPETFVPSE- 77 Query: 104 RRKKIAMVFQSFALMPHMTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPD 163 R+++ M+FQ +AL PH+TV +N FG++ G++ R+ + + L V LE YP Sbjct: 78 -RREVGMIFQDYALFPHLTVAENILFGVK--GLDKAARQARLGEMLALVKLEGLGGRYPH 134 Query: 164 ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISH 223 ELSGG +QRV +ARALA P++LL+DE FS +D +R EM E+ ++ + + VF++H Sbjct: 135 ELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEIREILKQRGVSAVFVTH 194 Query: 224 DLDEAMRIGDRIAIMQNGEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIAR 281 DEA D++A+ ++G + Q G+ + + P + YV F V+ KD AR Sbjct: 195 SKDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLGQVNYLSC-EVKDRAR 251 Lambda K H 0.319 0.137 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 342 Length adjustment: 30 Effective length of query: 370 Effective length of database: 312 Effective search space: 115440 Effective search space used: 115440 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory