GapMind for catabolism of small carbon sources

 

Aligments for a candidate for putP in Shewanella loihica PV-4

Align L-proline uptake porter, PutP (characterized)
to candidate 5209987 Shew_2435 sodium/proline symporter (RefSeq)

Query= TCDB::Q9I5F5
         (506 letters)



>lcl|FitnessBrowser__PV4:5209987 Shew_2435 sodium/proline symporter
           (RefSeq)
          Length = 483

 Score =  521 bits (1343), Expect = e-152
 Identities = 271/493 (54%), Positives = 345/493 (69%), Gaps = 13/493 (2%)

Query: 1   MSVNTPTLITFVIYIAAMVLIGLAAYRSTNNFSDYILGGRSLGSFVTALSAGASDMSGWL 60
           M++  P L+TF  Y+  M+ IGL AY++T++  DYILGGRS+G  VTALS GASDMSGWL
Sbjct: 1   MNIELPILVTFFGYLILMMGIGLWAYKATDSVDDYILGGRSMGPAVTALSVGASDMSGWL 60

Query: 61  LMGLPGAVYLSGLSESWIAIGLIVGAYLNWLFVAGRLRVQTEHNGNALTLPDYFTNRFED 120
           L+GLPGAVYL GL E+WI IGL+ GA+LNWLFVA RLR+ T+   NALTLPD+F  RFED
Sbjct: 61  LLGLPGAVYLGGLGEAWIGIGLVFGAWLNWLFVAKRLRIYTQFTDNALTLPDFFEKRFED 120

Query: 121 NSRLLRIFSALVILVFFTIYCASGIVAGARLFESTFGLSYETALWAGAAATIAYTFIGGF 180
              +L++ SA+ ILVFFT Y +SG+V GA LFE  FGL Y  AL  G+   +AYTF+GGF
Sbjct: 121 KQSVLKLVSAVTILVFFTFYTSSGMVGGAILFEKVFGLDYNLALLIGSGIIVAYTFVGGF 180

Query: 181 LAVSWTDTVQASLMIFALILTPVIVMLATGGVEPTFTAIELKDATSFDMLK-GASFIGVI 239
            AVSWTD  Q  LM+ AL++ PV +         T   I   D     +L    + IG+ 
Sbjct: 181 FAVSWTDFFQGCLMLIALLIVPVTIF----SQPETQNGIHSLDPAMLSLLSDNTTMIGLA 236

Query: 240 SLMAWGLGYFGQPHILARFMAADSVKSIPAARRISMTWMILCLGGAVAVGFFGIAYFQAH 299
           SL+AWGLGYFGQPHIL+RFMA  S   +  +RRI+M+WMI+ L GA+A G  G  YF   
Sbjct: 237 SLLAWGLGYFGQPHILSRFMAIGSADDLKVSRRIAMSWMIVALMGALATGLAGTLYFADQ 296

Query: 300 PEQAGAVSENPERVFIELAKILFNPWIAGVLLSAILAAVMSTLSCQLLVCSSALTEDFYK 359
           P       +NPE +FI LA   FNPWI G+L++AIL+A+MST+  QLLVCSS +TEDFYK
Sbjct: 297 P------IDNPETIFIHLAHAAFNPWIGGLLVAAILSAIMSTIDSQLLVCSSVITEDFYK 350

Query: 360 AFLRKGASQLELVWVGRAMVLLVAVIAIWLASNPENRVLGLVSYAWAGFGAAFGPLVLFS 419
            +LR  AS  EL+ +GR  VL +AVI+  +A NPE+ VL LVSYAWAGFGAAFGP+V+ S
Sbjct: 351 KWLRPDASSKELMMIGRIGVLTIAVISGVIALNPESSVLSLVSYAWAGFGAAFGPVVILS 410

Query: 420 LLWKRMTRNGALAGMIVGAATVILWKNLLGWT-GLYEIIPGFLFASVAIVVFSLLGKAPS 478
           L W+  +RNGA+A +IVGA TV+LWK   G    LYEI+PGFLFA++A V+ SL+  AP+
Sbjct: 411 LFWRGYSRNGAVATIIVGAITVVLWKQSTGGIFDLYEILPGFLFATLAGVLVSLV-SAPA 469

Query: 479 TSMLKRFDDAEQE 491
            S  ++F+   Q+
Sbjct: 470 DSTREQFEQFSQK 482


Lambda     K      H
   0.326    0.138    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 871
Number of extensions: 39
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 506
Length of database: 483
Length adjustment: 34
Effective length of query: 472
Effective length of database: 449
Effective search space:   211928
Effective search space used:   211928
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory