Align 2-methylisocitrate lyase; 2-MIC; MICL; (2R,3S)-2-methylisocitrate lyase; EC 4.1.3.30 (characterized)
to candidate 5209346 Shew_1820 2-methylisocitrate lyase (RefSeq)
Query= SwissProt::Q8EJW1 (292 letters) >FitnessBrowser__PV4:5209346 Length = 292 Score = 417 bits (1073), Expect = e-121 Identities = 209/289 (72%), Positives = 241/289 (83%) Query: 4 SAGLRFRQALANSKPLQIVGTTNAYFALMAEQTGFQALYLSGAGVANASYGLPDLGMTSM 63 SAG +FRQALA++KPLQIVGT NAY A+MA+Q G +A+YLSG GVANASYGLPDLGMTS+ Sbjct: 2 SAGKKFRQALADNKPLQIVGTINAYTAMMAKQIGHKAIYLSGGGVANASYGLPDLGMTSL 61 Query: 64 NDVLIDAGRITSATQLPLLVDIDTGWGGAFNIARTIKEFEKIGVAAVHMEDQVSQKRCGH 123 NDV++D RITSA LPLLVDIDTGWGGAFNIA+TIK+ EK G AAVHMEDQV+QKRCGH Sbjct: 62 NDVIVDVQRITSACDLPLLVDIDTGWGGAFNIAKTIKDMEKAGAAAVHMEDQVAQKRCGH 121 Query: 124 RPNKAVVSTEEMVDRIKAAVDARTDPNFVIMARTDAVAVEGLEAGIERAKAYIAAGADMI 183 RPNK +VS EEMVDRIKAAVDARTDP+F IMARTDA A EGLEA IERAKAY+AAGAD I Sbjct: 122 RPNKEIVSVEEMVDRIKAAVDARTDPDFFIMARTDAFAQEGLEAAIERAKAYVAAGADGI 181 Query: 184 FAEALTELDQYRHFKAQVKAPILANMTEFGQTQLFNKEELAQAGADMVLYPLGTFRAANQ 243 FAEA+ + YR F + PILAN+TEFGQT+L+N+E+L Q GA MVLYPL FRA N+ Sbjct: 182 FAEAVKTEEHYRAFAEALDVPILANITEFGQTELWNREQLGQWGAAMVLYPLSAFRAMNK 241 Query: 244 AALKVMQALMNDGHQRNVLDTMQTRADLYKYLGYHAFEDKLDQLFSQDK 292 AA V Q ++ DG Q+ VLDTMQTR +LY YLGYHA+E KLD LF++ K Sbjct: 242 AAENVYQTILRDGDQKAVLDTMQTRMELYDYLGYHAYEQKLDSLFAEGK 290 Lambda K H 0.319 0.132 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 292 Length adjustment: 26 Effective length of query: 266 Effective length of database: 266 Effective search space: 70756 Effective search space used: 70756 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate 5209346 Shew_1820 (2-methylisocitrate lyase (RefSeq))
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.16177.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-133 427.8 3.7 1e-132 427.6 3.7 1.0 1 lcl|FitnessBrowser__PV4:5209346 Shew_1820 2-methylisocitrate lya Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209346 Shew_1820 2-methylisocitrate lyase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.6 3.7 1e-132 1e-132 2 284 .. 4 287 .. 3 288 .. 0.99 Alignments for each domain: == domain 1 score: 427.6 bits; conditional E-value: 1e-132 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearritrvtklpllv 78 gk++r++l+ +++lqi+G+ina++a++a++ G++a+YlsG+++a+ s glPDlg+t+l++v+ +++rit++++lpllv lcl|FitnessBrowser__PV4:5209346 4 GKKFRQALADNKPLQIVGTINAYTAMMAKQIGHKAIYLSGGGVANaSYGLPDLGMTSLNDVIVDVQRITSACDLPLLV 81 799*****************************************989******************************* PP TIGR02317 79 DaDtGfGealnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaavkakkdedfvliaRtDara 156 D+DtG+G+a+n+a+t+k++e+ag+aavh+eDqva+k+CGh+++ke+vs eemv++ikaav+a++d+df+++aRtDa a lcl|FitnessBrowser__PV4:5209346 82 DIDTGWGGAFNIAKTIKDMEKAGAAAVHMEDQVAQKRCGHRPNKEIVSVEEMVDRIKAAVDARTDPDFFIMARTDAFA 159 ****************************************************************************** PP TIGR02317 157 veGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtefGktplltadeleelgykiviyPvtalR 234 +eGl+aaieRakaYv aGad if+ea+++ee++r fa+a++vp+lan+tefG+t l++ ++l + g ++v+yP++a+R lcl|FitnessBrowser__PV4:5209346 160 QEGLEAAIERAKAYVAAGADGIFAEAVKTEEHYRAFAEALDVPILANITEFGQTELWNREQLGQWGAAMVLYPLSAFR 237 ****************************************************************************** PP TIGR02317 235 aalkaaekvyeelkkkGtqkelldklqtRkelYellgyedyekkdkelfk 284 a++kaae+vy+++ ++G qk++ld++qtR elY+ lgy++ye+k+++lf+ lcl|FitnessBrowser__PV4:5209346 238 AMNKAAENVYQTILRDGDQKAVLDTMQTRMELYDYLGYHAYEQKLDSLFA 287 **********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 5.56 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory