Align PotG aka B0855, component of Putrescine porter (characterized)
to candidate 5208351 Shew_0863 ABC transporter-related protein (RefSeq)
Query= TCDB::P31134 (377 letters) >FitnessBrowser__PV4:5208351 Length = 342 Score = 217 bits (553), Expect = 3e-61 Identities = 131/340 (38%), Positives = 191/340 (56%), Gaps = 20/340 (5%) Query: 20 LEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKSTLLRMLAGFEQPSAGQIMLD 79 L I + Y GQ + + L +++GEI ALLG SGCGK+TLL+ +AG + S G+I ++ Sbjct: 4 LTIEQVHSDYQGQTILRGLDLVLHQGEIAALLGPSGCGKTTLLKAIAGLQPISQGRISIN 63 Query: 80 GVDLSQ----VPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDKLPKAEIASRVNEMLG 135 G LS VP R + M+FQ YALFPH+TV +NI FG+K L KA +R+ EML Sbjct: 64 GRLLSGPETFVPSERREVGMIFQDYALFPHLTVAENILFGVKG--LDKAARQARLGEMLA 121 Query: 136 LVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRDRMQLEVVDI 195 LV ++ R PH+LSGGQ+QRV++AR+LA P+LLLLDEP +D K+R M +E+ +I Sbjct: 122 LVKLEGLGGRYPHELSGGQQQRVSIARALAYEPELLLLDEPFSNIDAKVRGEMMVEIREI 181 Query: 196 LERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEHPTTRYSAEFIGSVNV 255 L++ GV+ V VTH ++EA A ++A+ G Q G E +Y PT +Y AEF+G VN Sbjct: 182 LKQRGVSAVFVTHSKDEAFVFADKLALFKDGGIAQYGSAESLYAEPTDKYVAEFLGQVNY 241 Query: 256 FEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPEKIMLCEEPPANGCNF 315 +K+R L+ ++ +D + LRPE++ + G Sbjct: 242 LSCEVKDRAR------LQTLLGEVQSSSDLPKAAGYRGELLLRPEQLQMA------GDEQ 289 Query: 316 AVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKG 355 G +I +LG+L Y + + G+ I A H G Sbjct: 290 GEGTIIARRFLGNLCHYSILI--GEEILAVRSPLHHFSPG 327 Lambda K H 0.321 0.137 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 342 Length adjustment: 29 Effective length of query: 348 Effective length of database: 313 Effective search space: 108924 Effective search space used: 108924 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory