Align sorbitol-6-phosphate dehydrogenase; EC 1.1.1.140 (characterized)
to candidate 5210113 Shew_2557 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= CharProtDB::CH_091827 (259 letters) >FitnessBrowser__PV4:5210113 Length = 306 Score = 76.6 bits (187), Expect = 6e-19 Identities = 59/194 (30%), Positives = 86/194 (44%), Gaps = 19/194 (9%) Query: 3 QVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQS-------------DKAANVAQEINAE 49 QVAVV G G LG LA G R+A++D S +K A E+ A+ Sbjct: 7 QVAVVTGAGAGLGRAYAIALAERGARLAIIDSGSGDSRCQSYAGAGLNKTARTLAELGAD 66 Query: 50 YGESMAYGFGADATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSL 109 F D T Q++ + V + +GR+D+ + +AGI + R L Sbjct: 67 -----CLSFQLDVTDSQALKSAIETVLKRWGRIDIAINNAGIHTPVSFDSLSFEQWQRQL 121 Query: 110 QVNLVGYFLCAREFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLA 169 V+L G F + M R GRI+ SG G H + YS +K VGL SLA Sbjct: 122 DVDLNGSFHLTKLVWPQMKRQNY-GRIVMTAGASGLYGDMHETPYSTSKMALVGLVNSLA 180 Query: 170 LDLAEYGITVHSLM 183 + +Y I+V++L+ Sbjct: 181 KEGRDYNISVNTLV 194 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 160 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 306 Length adjustment: 26 Effective length of query: 233 Effective length of database: 280 Effective search space: 65240 Effective search space used: 65240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory